DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2889 and CG4707

Sequence 1:NP_001245615.1 Gene:CG2889 FlyBaseID:FBgn0030206 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_611944.1 Gene:CG4707 FlyBaseID:FBgn0035036 Length:673 Species:Drosophila melanogaster

Alignment Length:633 Identity:153/634 (24%)
Similarity:264/634 (42%) Gaps:76/634 (12%)


  Fly     5 LCLRCLSPGSAVFLFETDDTLAETRLVKMIAKFLQLEILPDDGISTSVCTECCEHLEDFNGFWQL 69
            :|:.||...:|.:..::::.:.......:...|...|:|...| ...||.||...:..|..|.|.
  Fly     3 VCVLCLDSSNAGYGLQSEEGVRLNIRATIHKHFAFSEVLTAGG-DAEVCRECWNCVSSFEEFHQR 66

  Fly    70 V----EQKQCSLKKE---------------FLTVDVDCAAMKWTGGVDVDVNIDEL-PLAAGDMD 114
            |    .|:....|.|               ..:|::|..|..:....:|.|.::|| ||...::.
  Fly    67 VSCLHRQRSSDSKSEPIEFCGQTEEAIINPLYSVELDALAEAFFAPSEVKVEVNELEPLPKVELL 131

  Fly   115 EKPLDLHNLSLLGSVLDVNVDSVEVREPIKEQLPCEEEEDEKPCLQASDSEPEVTEGQPESESDS 179
            |.|:.....:....:...|..|...:..||.:||.:.:.| .|.....:|:.:.:...|...|::
  Fly   132 EDPVKTEIRTAPKRLGVPNEGSPHSKRRIKNELPVDSDSD-APLADFLNSDSKRSSVGPAKNSEA 195

  Fly   180 SDDE-----------PLVRLKSKMKPKR-------KTSARSSKD------QGPISLQQELADLLD 220
            :...           |..:.:|...||:       :.:||.:.|      :..:......:...:
  Fly   196 NKGRQLRRSARRGRPPKAKPESAPSPKKELDSEDGEENARDNNDMEFVAPEAVLGTDDSSSSSSE 260

  Fly   221 DGGKRRRRKAPDQRTTTESQESELQAVLERK-----------PKGCSRAQLAK------SYEKAI 268
            ..|:......||........|...:.|::.|           |...||.::.:      .|::.|
  Fly   261 SSGEDSDHSLPDIEPEERYAEIPKRVVVKPKKYRKREKPLVPPVRLSREEIERRKLQQDEYDEII 325

  Fly   269 ASYMSA-SCDLCEFSAPYLSELKTHFLEVHQREY-YIKCCGKVFTRASKLMDHIRKHINPKLFTC 331
            ..:... .|.||.......::::.|....|..|. ||:|||:.|.....|.:|:..|.||..|.|
  Fly   326 LQFFKKFPCSLCNLLVQNFADMRRHQRVSHNIESGYIECCGRKFHLRKALAEHVLVHKNPDHFMC 390

  Fly   332 TICKKSLNSQDYLATHIETVHNKVAQIGKVLK--FPCPKCERTFSSERRMANH-LAKH-DTDQLE 392
            :.|.:.......|..|.:|..|...:.....|  :.|.||.::|:::..|..| ::|| ...:.:
  Fly   391 SQCGRVFQDSRALEVHEQTHTNPEVKAEPKEKRIYQCEKCPKSFTTKAAMEYHDVSKHVPKSEFK 455

  Fly   393 HTCEICCKSFANVHRLRRHIQSIHEDLHRHVCDICGKKFKFKPSFER-HLLEHQGVVAP---AVE 453
            ::|..|.|......:|:.|::.:|:.....:||.|||..:.:.:.:: |.|||.....|   .|:
  Fly   456 YSCPECNKKIPTERKLKEHLRYMHDPEAAIICDKCGKTLRSQTNLKKHHELEHSEKPRPKPDPVQ 520

  Fly   454 CPICRVWLKNEHSLRLHRFT-HD--STDTVCPHCGKTCTSRTALRGHVKYAHKLTTNLQCTFCEK 515
            |.||..||::...|:.|..| |:  ..:..|..|.||.|:..||:.|:.:.|......:|..|||
  Fly   521 CEICGTWLRHLSGLKQHMKTVHEPPGDEHRCHICNKTSTNSRALKRHIYHNHLCERKFKCGMCEK 585

  Fly   516 TFKQQRNLDEHMAIHTGLQLYNCPHCPKECRSRSNMYVHIKQRHADEW 563
            .||:.::|.||.:.|||..||.||:||....|.:|||.|.::.|..||
  Fly   586 AFKRPQDLREHTSTHTGEVLYTCPNCPMTFFSNANMYKHRQRLHRAEW 633

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2889NP_001245615.1 zf-AD 2..79 CDD:285071 18/78 (23%)
C2H2 Zn finger 276..297 CDD:275368 4/21 (19%)
C2H2 Zn finger 306..323 CDD:275368 5/17 (29%)
C2H2 Zn finger 331..352 CDD:275368 5/21 (24%)
C2H2 Zn finger 366..386 CDD:275368 7/21 (33%)
C2H2 Zn finger 395..416 CDD:275368 5/21 (24%)
C2H2 Zn finger 424..444 CDD:275368 8/21 (38%)
C2H2 Zn finger 481..502 CDD:275368 8/21 (38%)
C2H2 Zn finger 510..530 CDD:275368 9/20 (45%)
C2H2 Zn finger 538..556 CDD:275368 9/18 (50%)
CG4707NP_611944.1 zf-AD 3..73 CDD:285071 16/71 (23%)
C2H2 Zn finger 334..355 CDD:275368 4/21 (19%)
LIM <361..407 CDD:295319 16/46 (35%)
C2H2 Zn finger 365..382 CDD:275368 5/17 (29%)
C2H2 Zn finger 390..410 CDD:275368 5/20 (25%)
C2H2 Zn finger 427..443 CDD:275368 5/16 (31%)
C2H2 Zn finger 458..476 CDD:275368 5/18 (28%)
C2H2 Zn finger 487..507 CDD:275368 7/20 (35%)
C2H2 Zn finger 521..540 CDD:275368 7/19 (37%)
C2H2 Zn finger 551..572 CDD:275368 8/21 (38%)
C2H2 Zn finger 580..600 CDD:275368 9/20 (45%)
C2H2 Zn finger 608..629 CDD:275368 9/21 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 H134721
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.