DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2889 and CG8388

Sequence 1:NP_001245615.1 Gene:CG2889 FlyBaseID:FBgn0030206 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_611075.1 Gene:CG8388 FlyBaseID:FBgn0034062 Length:572 Species:Drosophila melanogaster

Alignment Length:597 Identity:161/598 (27%)
Similarity:265/598 (44%) Gaps:109/598 (18%)


  Fly     1 MICRLCLRCL--SPGSAVFLFETDDTLAETRLVKMIAKFLQLEILPDDGISTSVCTECCEHLEDF 63
            |.|.||.:.:  :.|:..|..|..|:|.   |..:|.|...|:| ||...:..||..|.|.|..|
  Fly     1 MPCFLCTQTVDDAAGNIEFASEEADSLG---LRCIIEKHFWLQI-PDSKRAGYVCGPCWEQLLLF 61

  Fly    64 NGFWQLVEQKQCSLKKEFLTVDVDCAAMKWTGGVDVDVNIDELPLAAGDMDE-----------KP 117
            :.|:..|||...:|::         ..:|.|...:|..:..|..:...:.|:           :|
  Fly    62 HNFYLNVEQAHKALEQ---------TVLKETSPPEVVASALEEHIVKSEHDDSVAAAVKRRRGRP 117

  Fly   118 LDLHNLSL---LGSVLD-VNVDSVEVREP-----IKEQLPCEEEEDEKP--CLQASDSE-PEVTE 170
            ..:.....   |.|||: :|::.:::..|     |.:.|..:||:|..|  |:....:| |||.|
  Fly   118 RKVAQQDAREELKSVLEQINLNEIKIEFPEADLTIADVLEDQEEQDFLPDDCISKEGAEDPEVLE 182

  Fly   171 GQPESESDSSDDEPLVRLKSKMKPKRKTSARSSKDQGPISLQQELADLLDDGGKRRRRKAPDQRT 235
            .:|          |.:        |||.|.||.                   |:||.:.|     
  Fly   183 KKP----------PTL--------KRKVSGRSR-------------------GRRRVQLA----- 205

  Fly   236 TTESQESELQAVLERKPKGC-SRAQLAKSYEKAIASYMSASCDLCEFSAPYLSELKTHFLEVHQR 299
                         ||....| .:.|.::.:...|..:....|.:|.......||:..|....|::
  Fly   206 -------------ERPNTSCLPKIQKSQEFNDYIREHYKVQCHICNLPMEDFSEMLAHVRREHKQ 257

  Fly   300 EYYIKCCGKVFTRASKLMDHIRKHINPKLFTCTICKKSLNSQDYLATHIETVHNKVAQIGKVLKF 364
            ..|..||.:.|.:...|:||:|:|.:|:.|.|:||.:.:..:..|..|:..  :::...|::  :
  Fly   258 RGYAMCCNRKFLKRGVLVDHLRRHQDPETFKCSICGRVMGHRRSLELHMRM--HEIKSRGRL--Y 318

  Fly   365 PCPKCERTFSS----ERRMANHLAKHDTDQLEHTCEICCKSFANVHRLRRHIQSIHEDLHRHVCD 425
            .|.:|.:.|.|    ||....|:.:   :|.:..|..|.|::.:.:.:::|::.:|.:|:..:||
  Fly   319 RCEQCSKAFYSAVVYERHKLTHIPR---EQWKVPCTHCEKTYPSQYTMQQHVKLVHLNLYAKICD 380

  Fly   426 ICGKKFKFKPSFERHLLEHQGVVAPAVECPICRVWLKNEHSLRLH-RFTHDSTD---TVCPHCGK 486
            :|||..:.:.:..||:.||.|....|::|.:|...|..::.|..| :..|.:.:   ..|..|.|
  Fly   381 VCGKSIRGREALARHMEEHTGGPQAAIKCHLCDSMLTTKYGLARHIKMMHTAENLQPMQCEFCLK 445

  Fly   487 TCTSRTALRGHVKYAHKLTTNLQCTFCEKTFKQQRNLDEHMAIHTGLQLYNCPHCPKECRSRSNM 551
            .|.|..|.:.|:||.|....:.||..|||.||:...|.|||..|||..||.|||||:...|.:||
  Fly   446 ICPSLQAHQHHIKYTHNTARSHQCPMCEKAFKRPNELKEHMTTHTGEVLYTCPHCPQTFNSNANM 510

  Fly   552 YVHIKQRHADEW 563
            :.|.|:.|..||
  Fly   511 HAHRKKVHRKEW 522

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2889NP_001245615.1 zf-AD 2..79 CDD:285071 26/79 (33%)
C2H2 Zn finger 276..297 CDD:275368 5/21 (24%)
C2H2 Zn finger 306..323 CDD:275368 6/17 (35%)
C2H2 Zn finger 331..352 CDD:275368 5/21 (24%)
C2H2 Zn finger 366..386 CDD:275368 7/24 (29%)
C2H2 Zn finger 395..416 CDD:275368 4/21 (19%)
C2H2 Zn finger 424..444 CDD:275368 8/20 (40%)
C2H2 Zn finger 481..502 CDD:275368 9/21 (43%)
C2H2 Zn finger 510..530 CDD:275368 10/20 (50%)
C2H2 Zn finger 538..556 CDD:275368 9/18 (50%)
CG8388NP_611075.1 zf-AD <21..77 CDD:285071 21/60 (35%)
C2H2 Zn finger 264..281 CDD:275368 6/17 (35%)
C2H2 Zn finger 289..309 CDD:275368 5/22 (23%)
C2H2 Zn finger 320..340 CDD:275368 6/20 (30%)
C2H2 Zn finger 350..369 CDD:275368 4/19 (21%)
C2H2 Zn finger 440..461 CDD:275368 9/21 (43%)
C2H2 Zn finger 469..489 CDD:275368 10/20 (50%)
C2H2 Zn finger 497..515 CDD:275368 9/18 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 H134721
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.