DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2889 and ZK686.5

Sequence 1:NP_001245615.1 Gene:CG2889 FlyBaseID:FBgn0030206 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001023030.2 Gene:ZK686.5 WormBaseID:WBGene00022795 Length:263 Species:Caenorhabditis elegans

Alignment Length:288 Identity:63/289 (22%)
Similarity:110/289 (38%) Gaps:70/289 (24%)


  Fly    98 DVDVNIDELPLAAGDMDEKPLDLHNLSLLGSVLDVNVDSVEVREPIK--EQLPCEEEEDEK---P 157
            |:|:.|.:        |.|.|.::|..||.            ||.:|  ::| ||....|.   .
 Worm     3 DLDIEIVD--------DIKKLHIYNEYLLN------------RETLKATKEL-CELMSHESVGCS 46

  Fly   158 CLQASDSE-----PEVTEGQPESESD-------------SSDDEPLVRLKSKMKPKRKTSARSSK 204
            |.|....|     |:.|..||:.:.|             ||.........|.:..|::.:..::.
 Worm    47 CFQEFPVEKAPEMPDFTIIQPDRKFDGDNAAAVAGIFVRSSTSSSFPSASSYIAAKKRKNVDNTS 111

  Fly   205 DQGPISLQQELADLLDDGGKRRRRKAPDQRTTTESQESELQAV-----LERKPKGCSRAQLAKSY 264
            .:.|.|.:.           |:|:...:.|...:....:|..|     ::.:.:...:|...|..
 Worm   112 TRKPYSYKD-----------RKRKNTEEIRNIKKKLFMDLGIVRTNCGIDNEKQDREKAMKRKVT 165

  Fly   265 EKAIASYMSASCDLCEFSAPYLSELKTHFLEVHQREYYIKC--CGKVFTRASKLMDHIRKHINP- 326
            |..:.:|    |:|||.:......|..|..:||... ||:|  |.|:|::..:...|::.|..| 
 Worm   166 ETIVTTY----CELCEQNFSSSKMLLLHRGKVHNTP-YIECHLCMKLFSQTIQFNRHMKTHYGPN 225

  Fly   327 -KLFT-CTICKKSLNSQDYLATHIETVH 352
             |::. |.:|.:....:..|.||.:..|
 Worm   226 AKIYVQCELCDRQFKDKQSLRTHWDVSH 253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2889NP_001245615.1 zf-AD 2..79 CDD:285071
C2H2 Zn finger 276..297 CDD:275368 7/21 (33%)
C2H2 Zn finger 306..323 CDD:275368 4/17 (24%)
C2H2 Zn finger 331..352 CDD:275368 5/21 (24%)
C2H2 Zn finger 366..386 CDD:275368
C2H2 Zn finger 395..416 CDD:275368
C2H2 Zn finger 424..444 CDD:275368
C2H2 Zn finger 481..502 CDD:275368
C2H2 Zn finger 510..530 CDD:275368
C2H2 Zn finger 538..556 CDD:275368
ZK686.5NP_001023030.2 C2H2 Zn finger 173..194 CDD:275368 7/21 (33%)
C2H2 Zn finger 201..221 CDD:275368 5/20 (25%)
zf-C2H2_8 <204..251 CDD:292531 12/47 (26%)
C2H2 Zn finger 232..248 CDD:275368 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134626354
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.