DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2889 and CG11695

Sequence 1:NP_001245615.1 Gene:CG2889 FlyBaseID:FBgn0030206 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_572732.1 Gene:CG11695 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster

Alignment Length:590 Identity:173/591 (29%)
Similarity:253/591 (43%) Gaps:122/591 (21%)


  Fly     1 MICRLCLRCLSPGSAVFLFETDDT---LAETRLVKMIAKFLQLEILPDDGISTSVCTECCEHLED 62
            |||||||.  ....:|.:|:.||:   ...:.|.::|.|.|||.:||:||:|.|:||:|.:.|.|
  Fly     1 MICRLCLD--DAEHSVPIFDQDDSGDQPVPSNLAELIEKHLQLVLLPNDGVSKSLCTQCWQQLAD 63

  Fly    63 FNGFWQLVEQKQCSLKKEFLTVDVDCAAMKWTGGVDVDVNIDELPLAAGDMDEKPLDLHNLSLLG 127
            |..|..:|.:||..|:                          :|.:.....||            
  Fly    64 FEQFCAMVMKKQLGLQ--------------------------QLKMEPFSEDE------------ 90

  Fly   128 SVLDVNVDSVEVREPIKEQLPCEEEEDEKPCLQASDSEPEVTEGQPESESDSSDDEPLVRLKSKM 192
                 :.|:       |.|:.||.|.|..|. .|.:.|....:|...|.|.||.           
  Fly    91 -----DADT-------KAQILCEPEIDVSPA-AADNEECNEIDGDASSNSRSSS----------- 131

  Fly   193 KPKRKTSARSSKDQGPISLQQELADLLDDGGKRRRRKAP-------------DQRTTTESQESEL 244
              .|.||.|..:...||               |||.:.|             ..||.|...|::.
  Fly   132 --IRTTSLREMRLPSPI---------------RRRMRLPRAVTAPKTQAVKAKARTKTHKAEADE 179

  Fly   245 QAVLERKPKGCSRAQLAKSYEKAIASYMSASCDLC--EFSAPYLSELKTHFLEVHQREYYIKCCG 307
            ....|.:....||:..::..:..||.:....|.:|  :...|..:|:|.||...||...|:.||.
  Fly   180 DEDAEGEGDPESRSSNSREMDSYIALHGRLECCICGGDEQFPNFAEMKRHFRNHHQSLGYVVCCQ 244

  Fly   308 KVFTRASKLMDHIRKHINPKLFTCTICKKSLNSQDYLATHIETVH-NKVAQIGKVLKFPCPKCER 371
            :.:.:.:..:||:..|.:|..|.|.||.|.|.|:.....|:...| ||     ..|.|.|.:|.:
  Fly   245 RRYKKRALYVDHLHMHNDPNYFRCKICSKQLVSRISYDVHMLRFHPNK-----DDLSFACDQCSK 304

  Fly   372 TFSSERRMANHLAKHDTDQLEHTCEICCKSFANVHRLRRHIQSIHEDLH-RHVCDICGKKFKFKP 435
            .||.:..:..|...|..::.|. |:.|.:||.....||.|::..|:... ..:||.||.|||.| 
  Fly   305 RFSKQFLLTIHSRVHQQERNEQ-CKHCDRSFRTAVDLRLHMRRTHDPAFVPFICDSCGAKFKTK- 367

  Fly   436 SFERHLLEH------QGVVAPAVECPICRVWLKNEHSLRLHRFTHDSTDTV----CPHCGKTCTS 490
               ::||.|      :|...|.|:|..|:|||.:|:|||.|.:.|....::    |..||....|
  Fly   368 ---QNLLVHKRTVHREGSQLPEVQCQECQVWLSDENSLRKHMYMHLDAASLRQWKCEQCGLEKGS 429

  Fly   491 RTALRGHVKYAHKLTTNLQCTFCEKTFKQQRNLDEHMAIHTGLQLYNCPHCPKECRSRSNMYVHI 555
            |..|..|::|.|....: :||.|.|.||..|:|:||.|.|||..||.|..|.:..::..||:.|.
  Fly   430 RAKLAAHIRYHHPKEYH-KCTHCAKEFKSSRSLEEHTATHTGQDLYECAFCERTFKNSGNMHKHR 493

  Fly   556 KQRHA 560
            :|.||
  Fly   494 RQMHA 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2889NP_001245615.1 zf-AD 2..79 CDD:285071 33/80 (41%)
C2H2 Zn finger 276..297 CDD:275368 7/23 (30%)
C2H2 Zn finger 306..323 CDD:275368 3/17 (18%)
C2H2 Zn finger 331..352 CDD:275368 7/21 (33%)
C2H2 Zn finger 366..386 CDD:275368 5/20 (25%)
C2H2 Zn finger 395..416 CDD:275368 7/21 (33%)
C2H2 Zn finger 424..444 CDD:275368 10/20 (50%)
C2H2 Zn finger 481..502 CDD:275368 8/21 (38%)
C2H2 Zn finger 510..530 CDD:275368 11/20 (55%)
C2H2 Zn finger 538..556 CDD:275368 5/18 (28%)
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 33/107 (31%)
C2H2 Zn finger 268..289 CDD:275368 7/21 (33%)
C2H2 Zn finger 299..319 CDD:275368 5/20 (25%)
C2H2 Zn finger 327..348 CDD:275368 7/21 (33%)
C2H2 Zn finger 357..376 CDD:275368 11/23 (48%)
C2H2 Zn finger 389..409 CDD:275368 10/20 (50%)
C2H2 Zn finger 420..440 CDD:275368 8/20 (40%)
C2H2 Zn finger 448..468 CDD:275368 11/20 (55%)
C2H2 Zn finger 476..494 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 H134721
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.