DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2889 and Zfy2

Sequence 1:NP_001245615.1 Gene:CG2889 FlyBaseID:FBgn0030206 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_033597.2 Gene:Zfy2 MGIID:99213 Length:777 Species:Mus musculus

Alignment Length:718 Identity:156/719 (22%)
Similarity:242/719 (34%) Gaps:223/719 (31%)


  Fly    18 LFETD--------------DTLAETRLVKMIAKFLQLEILPDDGISTS------VCTECCEHLED 62
            |.|||              ||..|..|    |:||..:||.....|||      |......|:.:
Mouse    80 LEETDISDNVIIPEQVLDLDTAEEVSL----AQFLIPDILTSSITSTSLTMPEHVLMSEAIHVSN 140

  Fly    63 FNGFWQLVEQKQCSLKKEF----LTVDV-DCAAMKWTGGVDVDVNIDELPLAAGD---------- 112
            ...|.|::...  .:::|.    ||.|: |.....|.....:|.:  .:||...|          
Mouse   141 VGHFEQVIHDS--LVEREIITDPLTADISDILVADWASEAVLDSS--GMPLEQQDDARINCEDYL 201

  Fly   113 ---MDEKPLDLHNLSLLGSVLDVNVDSVEVREPIKEQLP-----C-----EEEEDEKPCLQASDS 164
               :||.....|..|   |.:.:|.:|......:.|..|     |     .|.:|....:||.:|
Mouse   202 MMSLDEPSKTDHEGS---SEVTMNAESETDSSKLDEASPEVIKVCILKADSEVDDVGETIQAVES 263

  Fly   165 ------EPEVTEGQ--------------PESESDSSDDEPLV----------------------R 187
                  |.|||:.:              .:|:.:..|.:.:|                      .
Mouse   264 ETDNGNEAEVTDQRTSIHVPRVNIYMLASDSQKEEEDTKVIVGDEDAGGTAADTPEHEQQMDVSE 328

  Fly   188 LKSKMKPKRKTSARSSKDQGPISLQQELADLL----DDGG---------KRRRRK---------- 229
            :|:...|...|:|..: :...|.:|...|..:    :.||         |:::|.          
Mouse   329 IKAAFLPIAWTAAYDN-NSDEIEVQNATASAMLHHDESGGLDRVPKQKSKKKKRPESKQYQSAIF 392

  Fly   230 -APDQRT------------------------------------TTE-------------SQESEL 244
             |||.:|                                    .||             ..||..
Mouse   393 VAPDGQTLRVYPCMFCGKKFKTKRFLKRHIKNHPEYLANKKYHCTECDYSTNKKISLHNHMESHK 457

  Fly   245 QAVLERKPKGCSRAQLAKSY------EKAIASYMSASCDLCEFSAPYLSELKTHFLEVHQREYYI 303
            ..:...|...|...:...|:      ||.:..  :..|..|::.....:.|..|.|.||::::..
Mouse   458 LTIKTEKTTECDDCRKNLSHAGTMHTEKGVNK--TCKCKFCDYETAEQTLLNHHLLVVHRKKFPH 520

  Fly   304 KC--CGKVFTRASKLMDHIRKHINPKLFTCTICK-KSLNSQDYLATHIETVHNKVAQIGKVLKFP 365
            .|  |||.|...|.|..|||.|...|.:.|..|: ||.:|.: |.|||::.|:      |.:...
Mouse   521 ICGECGKGFRHPSALKKHIRVHTGEKPYECQYCEYKSADSSN-LKTHIKSKHS------KEIPLK 578

  Fly   366 CPKCERTFSSERRMANHLAKHDTDQLEHTCEICCKSFANVHRLRRHIQSIHEDLHRHVCDICGKK 430
            |..|..|||..:....|...|. :...|.|..|....:|...|:|||.|:|...:.|.||:|.|.
Mouse   579 CGICLLTFSDTKEAQQHAVLHQ-ESRTHQCSHCNHKSSNSSDLKRHIISVHTKAYPHKCDMCSKG 642

  Fly   431 FKFKPSFERHLLEHQGVVAPAVECPICRVWLKNEHSLRLHRFTHDSTDTVCPHCGKTCTSRTALR 495
            |......::|:..|:                    |.::|:         |.||.........|.
Mouse   643 FHRPSELKKHVATHK--------------------SKKMHQ---------CRHCDFKSPDPFLLS 678

  Fly   496 GHVKYAHKLTTNLQCTFCEKTFKQQRNLDEHMAIHTGLQLYNCPHCPKECRSRSNMYVHIKQRHA 560
            .|:..||......:|..|:|.|:||..|..||..|:..::|.|.:|....:..|....|:...|.
Mouse   679 HHILSAHTKNVPFKCKRCKKEFQQQCELQTHMKTHSSRKVYQCEYCEYSTKDASGFKRHVISIHT 743

  Fly   561 DEW 563
            .::
Mouse   744 KDY 746

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2889NP_001245615.1 zf-AD 2..79 CDD:285071 20/81 (25%)
C2H2 Zn finger 276..297 CDD:275368 6/21 (29%)
C2H2 Zn finger 306..323 CDD:275368 9/17 (53%)
C2H2 Zn finger 331..352 CDD:275368 9/22 (41%)
C2H2 Zn finger 366..386 CDD:275368 6/20 (30%)
C2H2 Zn finger 395..416 CDD:275368 8/21 (38%)
C2H2 Zn finger 424..444 CDD:275368 6/20 (30%)
C2H2 Zn finger 481..502 CDD:275368 6/21 (29%)
C2H2 Zn finger 510..530 CDD:275368 9/20 (45%)
C2H2 Zn finger 538..556 CDD:275368 4/18 (22%)
Zfy2NP_033597.2 Zfx_Zfy_act 68..388 CDD:282547 63/320 (20%)
Nuclear localization signal. {ECO:0000255} 372..382 2/10 (20%)
C2H2 Zn finger 405..425 CDD:275370 0/20 (0%)
C2H2 Zn finger 436..456 CDD:275368 4/20 (20%)
COG5048 <442..681 CDD:227381 69/278 (25%)
C2H2 Zn finger 493..514 CDD:275368 6/21 (29%)
zf-C2H2 520..542 CDD:278523 10/22 (45%)
C2H2 Zn finger 522..542 CDD:275368 10/20 (50%)
zf-H2C2_2 534..556 CDD:290200 8/22 (36%)
C2H2 Zn finger 550..571 CDD:275368 9/22 (41%)
C2H2 Zn finger 579..599 CDD:275368 6/20 (30%)
C2H2 Zn finger 607..628 CDD:275368 8/21 (38%)
C2H2 Zn finger 636..685 CDD:275368 15/78 (19%)
C2H2 Zn finger 693..713 CDD:275368 9/20 (45%)
C2H2 Zn finger 721..742 CDD:275368 4/21 (19%)
C2H2 Zn finger 750..770 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.