DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2889 and spr-3

Sequence 1:NP_001245615.1 Gene:CG2889 FlyBaseID:FBgn0030206 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001024367.1 Gene:spr-3 WormBaseID:WBGene00005008 Length:684 Species:Caenorhabditis elegans

Alignment Length:311 Identity:68/312 (22%)
Similarity:110/312 (35%) Gaps:60/312 (19%)


  Fly   286 LSELKTHFLEVHQREYYIKCCGKVFTRASKLMDHIRKHINPKLFTCTICKKSLNSQDYLATHIET 350
            |.|||..  :..|..|....||:.|.|...|..|:|:|. |..|.|..|..:...:.....|:..
 Worm     8 LEELKNE--QGEQGSYKCHLCGQCFYRGCGLASHLRRHA-PVTFDCEHCAYTCKHKYAYDRHLLQ 69

  Fly   351 VHNKVAQIGKVLKF--------PCPKCERTFSSERRMANHLAKHDT-------DQLEHTCEICCK 400
            .|.::.:.|.:::.        |.|..||    |..:::...|::.       :.:.:.|.:|..
 Worm    70 SHPELVESGPLVRMFKNEDEDAPMPILER----EADVSDDAVKYEALSSFSEPEPISYKCPLCIS 130

  Fly   401 SFANVHRLRRHIQSIHEDLHRHVCDICGKKFKFKPSFERHL--------LEHQGVVA-------P 450
            :|.:..|...||.|     ||.......|..||   |.|..        ||.|.::.       .
 Worm   131 TFGSHARAVYHILS-----HRVKLYQAPKSLKF---FSRKTMQALGGFRLESQLMIKWRLQYDNR 187

  Fly   451 AVECPICRVWLKNEHSLRLHRFTHDSTDTVCPHCGKTCTSRTALRGHVKYAHKLTTNLQCTFCEK 515
            :|:....|:|...|.:...........::..|....:..|:|.|........||...     |..
 Worm   188 SVDEKRTRLWRYMEENFGHEHLKQPKLESDNPSTSSSFESQTNLNDSSIIKKKLVMK-----CGT 247

  Fly   516 TFKQQRNLDEHMAIHTGLQLYNCPHCPKECRSRSNMYVHIK---QRHADEW 563
            .|.|:       .||...|.|.|.:||....:.|:::.|.:   |:....|
 Worm   248 VFGQR-------LIHDNTQYYLCRNCPYVSWNVSSLWRHFRHHIQKSKQSW 291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2889NP_001245615.1 zf-AD 2..79 CDD:285071
C2H2 Zn finger 276..297 CDD:275368 4/11 (36%)
C2H2 Zn finger 306..323 CDD:275368 7/17 (41%)
C2H2 Zn finger 331..352 CDD:275368 3/21 (14%)
C2H2 Zn finger 366..386 CDD:275368 5/20 (25%)
C2H2 Zn finger 395..416 CDD:275368 7/21 (33%)
C2H2 Zn finger 424..444 CDD:275368 7/28 (25%)
C2H2 Zn finger 481..502 CDD:275368 4/21 (19%)
C2H2 Zn finger 510..530 CDD:275368 4/20 (20%)
C2H2 Zn finger 538..556 CDD:275368 5/18 (28%)
spr-3NP_001024367.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S12372
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.