DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2889 and ZNF197

Sequence 1:NP_001245615.1 Gene:CG2889 FlyBaseID:FBgn0030206 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001310222.1 Gene:ZNF197 HGNCID:12988 Length:1029 Species:Homo sapiens

Alignment Length:428 Identity:112/429 (26%)
Similarity:159/429 (37%) Gaps:127/429 (30%)


  Fly   251 KPKGCSRAQL-AKS---YEKAIASYMSASCDLCE--FSAPYLSELKTHFLE---VHQREYYIKC- 305
            |.|.|.:..: :||   :::......:..|..|.  ||:      |::|::   :|.||...|| 
Human   567 KCKECGKVFIRSKSLLLHQRVHTEKKTFGCKKCGKIFSS------KSNFIDHKRMHSREKPYKCT 625

  Fly   306 -CGKVFTRASKLMDHIRKHINPKLFTCTIC------KKSL----------------------NSQ 341
             |||.||:::.|.||.|.|...|.:.|..|      ||||                      .|.
Human   626 ECGKAFTQSAYLFDHQRLHNGEKPYECNECGKVFILKKSLILHQRFHTGENLYECKDCGKVFGSN 690

  Fly   342 DYLATHIETVHN---------------------------------KVAQIGKVLK---------- 363
            ..|..| |.:||                                 |....||...          
Human   691 RNLIDH-ERLHNGEKPYECRECGKTFIMSKSFMVHQKLHTQEKAYKCEDCGKAFSYNSSLLVHRR 754

  Fly   364 -------FPCPKCERTFSSERRMANHLAKHDTDQLEHTCEICCKSFANVHRLRRHIQSIHEDLHR 421
                   |.|.:|.|.|||.|.:..|...|..:: .:.|:.|.|.|.....|..| |.||.....
Human   755 IHTGEKPFECSECGRAFSSNRNLIEHKRIHSGEK-PYECDECGKCFILKKSLIGH-QRIHTREKS 817

  Fly   422 HVCDICGKKFKF--------------KP----------SFERHLLEHQGVVA--PAVECPICRVW 460
            :.|:.|||.|.:              ||          ::.|:|:|||.:.:  ...||.:||..
Human   818 YKCNDCGKVFSYRSNLIAHQRIHTGEKPYACSECGKGFTYNRNLIEHQRIHSGEKTYECHVCRKV 882

  Fly   461 LKNEHSLRLHRFTHDSTDTV-CPHCGKTCTSRTALRGHVKYAHKLTTNLQCTFCEKTFKQQRNLD 524
            |.:..:|.:|:..|...... |..|||..:....|..|.: .|......:|..|.|:|..:|||.
Human   883 LTSSRNLMVHQRIHTGEKPYKCNECGKDFSQNKNLVVHQR-MHTGEKPYECDKCRKSFTSKRNLV 946

  Fly   525 EHMAIHTGLQLYNCPHCPKECRSRSNMYVHIKQRHADE 562
            .|..||||.:.|.|..|.|..|.|.|:.|| ::.|.||
Human   947 GHQRIHTGEKPYGCNDCSKVFRQRKNLTVH-QKIHTDE 983

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2889NP_001245615.1 zf-AD 2..79 CDD:285071
C2H2 Zn finger 276..297 CDD:275368 6/26 (23%)
C2H2 Zn finger 306..323 CDD:275368 9/17 (53%)
C2H2 Zn finger 331..352 CDD:275368 10/49 (20%)
C2H2 Zn finger 366..386 CDD:275368 8/20 (40%)
C2H2 Zn finger 395..416 CDD:275368 8/21 (38%)
C2H2 Zn finger 424..444 CDD:275368 10/44 (23%)
C2H2 Zn finger 481..502 CDD:275368 6/21 (29%)
C2H2 Zn finger 510..530 CDD:275368 9/20 (45%)
C2H2 Zn finger 538..556 CDD:275368 8/18 (44%)
ZNF197NP_001310222.1 SCAN 38..150 CDD:128708
KRAB 216..256 CDD:307490
C2H2 Zn finger 372..392 CDD:275368
zf-H2C2_2 384..409 CDD:316026
C2H2 Zn finger 400..420 CDD:275368
COG5048 424..853 CDD:227381 68/295 (23%)
C2H2 Zn finger 428..448 CDD:275368
C2H2 Zn finger 456..476 CDD:275368
C2H2 Zn finger 484..504 CDD:275368
C2H2 Zn finger 512..532 CDD:275368
C2H2 Zn finger 540..560 CDD:275368
C2H2 Zn finger 568..588 CDD:275368 4/20 (20%)
C2H2 Zn finger 596..616 CDD:275368 6/26 (23%)
C2H2 Zn finger 624..644 CDD:275368 10/20 (50%)
C2H2 Zn finger 652..672 CDD:275368 6/20 (30%)
C2H2 Zn finger 680..700 CDD:275368 4/21 (19%)
C2H2 Zn finger 708..728 CDD:275368 0/20 (0%)
C2H2 Zn finger 736..756 CDD:275368 2/20 (10%)
COG5048 760..>1026 CDD:227381 70/229 (31%)
C2H2 Zn finger 764..784 CDD:275368 8/20 (40%)
C2H2 Zn finger 792..812 CDD:275368 8/21 (38%)
C2H2 Zn finger 820..840 CDD:275368 5/20 (25%)
C2H2 Zn finger 848..868 CDD:275368 5/20 (25%)
C2H2 Zn finger 876..896 CDD:275368 6/20 (30%)
C2H2 Zn finger 904..924 CDD:275368 6/21 (29%)
C2H2 Zn finger 932..952 CDD:275368 9/20 (45%)
C2H2 Zn finger 960..980 CDD:275368 8/21 (38%)
C2H2 Zn finger 988..1008 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S12372
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.