DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2889 and prdm5

Sequence 1:NP_001245615.1 Gene:CG2889 FlyBaseID:FBgn0030206 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_002940365.2 Gene:prdm5 XenbaseID:XB-GENE-854777 Length:631 Species:Xenopus tropicalis

Alignment Length:526 Identity:129/527 (24%)
Similarity:200/527 (38%) Gaps:136/527 (26%)


  Fly    71 EQKQCSLKKE-----FLTVDVDCAAMKWTGGVDVDVNID-ELPLAAGDMDEKPLDLHNLSLLGSV 129
            |:|..:..:|     :|.||              |:..| ||.:...|.|.:..:..|..:    
 Frog    92 EKKNLAAIQEGENIFYLAVD--------------DIETDTELLIGYLDSDMEEAEEENTEI---- 138

  Fly   130 LDVNVDSVEVREPIKE-QLPCEEE-----EDEKPCLQASDSEPEVTEGQPESESDSSDDEPLVRL 188
              |||.:.|..|.||| |.|.|:|     ||.: |.....|.|          |.....|.|..|
 Frog   139 --VNVVNKEEDENIKESQQPSEKEYITYKEDHR-CPHCESSFP----------SQEILAEHLQAL 190

  Fly   189 KSKMKPKRKTSARSSKDQGPISLQQELADLLDDGGKRRRRKAPDQRTTTESQESELQAVLERKPK 253
            ..|...:::...|:...:.|:                                   :..|:|...
 Frog   191 HQKPVEEKEFKCRNCGKKFPV-----------------------------------KQALQRHVL 220

  Fly   254 GCSRAQLAKSYEKAIASYMSAS--CDLCEFSAPYLSELKTHFLEVHQR------EYYIKC--CGK 308
            .|:        |..|:...|:|  |.:|..|  :.|.|.   ||.|:.      .:..|.  |||
 Frog   221 QCT--------ENIISGDSSSSYQCSVCNSS--FGSSLS---LEQHREACKGDARFICKADSCGK 272

  Fly   309 VFTRASKLMDHIRKH-------INPKLFTCTICKK----SLNSQDYLATHIETVHNKVAQIGKVL 362
            .|    :..|.::||       .:.|...|::|.|    |||.|:         |.||.:|    
 Frog   273 RF----RSKDTLKKHKENVHTGNSKKKLMCSVCNKKCSSSLNLQE---------HRKVHEI---- 320

  Fly   363 KFPCPKCERTFSSERRMANHLAKHDTDQLEHTCEICCKSFANVHRLRRHIQSIHEDLHRHVCDIC 427
             :.|..|::.|.|..::..|:..| :::...|||:|||||..:.::..| :.||.:...:.|.:|
 Frog   321 -YECQDCDKKFISANQLRRHMITH-SEKRPFTCEVCCKSFKRLDQVTAH-KIIHSEDKPYQCKLC 382

  Fly   428 GKKFKFKPSFERHLLEHQGVVAPAVECPICRVWLKNEHSLRLHRFTHDSTDTV-CPHCGKTCTSR 491
            ||.|..:..::.|...|.  .....:|..|:...:...||:.|...|:|..|. |.||..|...:
 Frog   383 GKGFAHRNVYKNHKKTHS--EERPFQCEECKALFRTPFSLQRHLLIHNSERTFKCDHCDATFKRK 445

  Fly   492 TALRGHVKYAHKLTTNLQCTFCEKTFKQQRNLDEHMAIHTGLQLYNCPHCPKECRSRSNMYVHIK 556
            ..|..|::..|......:|..|:|.|.....|..|...|||.:...||:|.::..|...:.|||:
 Frog   446 DTLNVHIQVVHDGHKKYKCDLCDKAFVTPSVLKSHKKTHTGEKEKICPYCGQKFASNGTLRVHIR 510

  Fly   557 QRHADE 562
            . |..|
 Frog   511 S-HTGE 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2889NP_001245615.1 zf-AD 2..79 CDD:285071 2/8 (25%)
C2H2 Zn finger 276..297 CDD:275368 7/21 (33%)
C2H2 Zn finger 306..323 CDD:275368 6/17 (35%)
C2H2 Zn finger 331..352 CDD:275368 7/25 (28%)
C2H2 Zn finger 366..386 CDD:275368 5/20 (25%)
C2H2 Zn finger 395..416 CDD:275368 9/21 (43%)
C2H2 Zn finger 424..444 CDD:275368 6/20 (30%)
C2H2 Zn finger 481..502 CDD:275368 6/21 (29%)
C2H2 Zn finger 510..530 CDD:275368 6/20 (30%)
C2H2 Zn finger 538..556 CDD:275368 7/18 (39%)
prdm5XP_002940365.2 SET 20..123 CDD:214614 10/45 (22%)
C2H2 Zn finger 170..191 CDD:275368 7/31 (23%)
COG5048 198..621 CDD:227381 94/390 (24%)
C2H2 Zn finger 202..222 CDD:275368 4/55 (7%)
C2H2 Zn finger 237..257 CDD:275368 8/25 (32%)
C2H2 Zn finger 270..288 CDD:275368 7/22 (32%)
C2H2 Zn finger 298..318 CDD:275368 10/29 (34%)
C2H2 Zn finger 323..343 CDD:275368 5/20 (25%)
zf-H2C2_2 336..360 CDD:290200 10/25 (40%)
C2H2 Zn finger 351..371 CDD:275368 9/21 (43%)
C2H2 Zn finger 379..399 CDD:275368 6/20 (30%)
C2H2 Zn finger 407..427 CDD:275368 5/20 (25%)
C2H2 Zn finger 435..456 CDD:275368 6/21 (29%)
C2H2 Zn finger 464..484 CDD:275368 6/20 (30%)
C2H2 Zn finger 492..512 CDD:275368 7/21 (33%)
zf-H2C2_2 505..528 CDD:290200 5/13 (38%)
C2H2 Zn finger 520..540 CDD:275368
zf-H2C2_2 533..557 CDD:290200
C2H2 Zn finger 548..568 CDD:275368
zf-H2C2_2 561..584 CDD:290200
C2H2 Zn finger 576..596 CDD:275368
C2H2 Zn finger 605..622 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.