DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atp10b and CG33298

Sequence 1:XP_017170094.1 Gene:Atp10b MGIID:2442688 Length:1484 Species:Mus musculus
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1452 Identity:563/1453 (39%)
Similarity:808/1453 (56%) Gaps:255/1453 (18%)


Mouse    19 WLRWK------WRTQDGFSQS------PSETTPLLSPETDRQSHNTAEQRVVYPNNSMCHQDWKK 71
            |  ||      :.|.|.|.:.      |:.|.|   |:|.::.|         ||.         
  Fly   207 W--WKRLTLCNYNTGDKFEERSYRTVVPNHTVP---PKTPKRDH---------PNG--------- 248

Mouse    72 VCRRYPGNSICTTKYTLLTFLPQNLFEQFHRWANLYFLFLVILNWMPSMEVFHREITIFPLATVL 136
               ::.||.|.|||||||:|:|:||.|||||.|||||:|:|:|||:|.:..|.:|:.:.|:..||
  Fly   249 ---QFVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIPVLFVL 310

Mouse   137 LIIMVKDGIEDFKRYCFDREMNSASIQIYERKEQRYMLKRWQDVRVGDFVQMQCNEIVPADILLL 201
            .:..|||..||.:|...|:.:|:.:.::|:.:.:||...:||::||||.|.:..||.||||||||
  Fly   311 GVTAVKDLFEDRRRRASDKRINNTTCRVYDGETERYKKVKWQELRVGDIVHLSNNETVPADILLL 375

Mouse   202 FSSDPSGVCHLETANLDGETNLKQRRVVKGFSQPEVQFQPEHFHSTIVCEKPNNHLSKFKGYMEH 266
            .:|||.|||:::|.:||||||||:|.||:||.:.:..|.|..|.|.:..:.|...|.:|.|.:.|
  Fly   376 RTSDPQGVCYIDTCDLDGETNLKRREVVRGFEEMQSIFVPSKFVSRVEADAPTTKLYRFHGALIH 440

Mouse   267 PDQTRTGFGSESLLLRGCTIRNTEVAAGIVIYAGHETKAMLNNSGPRYKRSKIERRINTDIFFCI 331
            |...|....:|.||||...::||:...|||:|||||||:||||||||||||::|:::|.|:.:|:
  Fly   441 PTGERVPISTECLLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNIDVIWCV 505

Mouse   332 GLLFLMCLIGAVGHSLWNGTFKEHPPFDVPDADGNFLSLALGGFYMFLTMIILLQVLIPISLYVS 396
            .:|.::|::||:|..:|..:|...|   ||....|.|:..:...::|.|.|::|||:||:||||:
  Fly   506 IILLILCVVGAIGCRMWLSSFTHFP---VPYLPPNKLTANMESMWIFWTYIVILQVMIPLSLYVT 567

Mouse   397 IELVKLGQVFLLHNDLDLYDEETDLSIQCRALNITEDLGQIQYIFSDKTGTLTENKMVFRRCTIV 461
            |||.|:.|||.:||::||:|.||:...:|||:||||:|||||:||:|||||||||||:||||.:.
  Fly   568 IELCKILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIFRRCVVN 632

Mouse   462 GSEYCHQENAKRLEMPKELDSDGEEWTQYQCLSFPPRWAQGSTTMRSQGGAQPLRRCHSARVPIQ 526
            ||:|.|.        |.||:.                       :.|:.||              
  Fly   633 GSDYNHP--------PSELEK-----------------------IYSKPGA-------------- 652

Mouse   527 SHCRQRSVGRWETSQPPVAFSSSIEKDVTPDKNLLSKVRDAALWLETSDTRPAKPSHSTTASIAD 591
                         ..||          :.|:.||.|.:  |.|...|..|..|:       .|.:
  Fly   653 -------------PAPP----------LIPNDNLNSDM--AQLTQGTYLTPHAQ-------RIQE 685

Mouse   592 FFLALTICNSVMVSTTTEPRK------------RVTTPPANKALGTSLEKIQQLFQRLKLLSLSQ 644
            |.:.|.|||:|:|...  |.:            ::...|||...|.         ||.|||:.|.
  Fly   686 FLVVLAICNTVIVGAA--PHRDMMNASGIIEVQQIGNSPANLKHGK---------QRQKLLASST 739

Mouse   645 SFSSTA---------------PSD--TDLGESLG------PNL----------PTID-------- 668
            |.::|.               |:|  ..|.||..      |||          ||:.        
  Fly   740 STTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLSPISSSAES 804

Mouse   669 --SDEKDDTSVCSGDCSTDGGYRSSTWEQGDILGSESGTSLEEGLEAPT---------------- 715
              :.|.:..|....:.|..... |.|.....::.|:. ||:...|.|.|                
  Fly   805 SPNSESESPSPPMKNKSLSNSI-SPTGRAKAVINSKI-TSIATFLNAKTQGKRMKLPSSKTGTIY 867

Mouse   716 -LSQDEPELCYEAESPDEAALVHAARAYSFTLVSRTPEQVTVRLPQ-GICLTFDLLFTLGFDSVR 778
             .:...|  .||||||||.|||:||.:|...|::|:|.|:.|.:|. |....:::|..|.|||.|
  Fly   868 RTADGRP--LYEAESPDELALVNAAYSYDCCLLNRSPNQILVSMPMAGATREYEILKVLPFDSSR 930

Mouse   779 KRMSVVVRHPLTDEIIVYTKGADSVIMDLLEDPACESNIDVEKKLKRIRARTQKHLDLYARDGLR 843
            |.||:|||...:.||::|||||||.||.:|...:..|...:      :|.:||:.||.|||:|||
  Fly   931 KCMSIVVRQIGSQEIVLYTKGADSSIMPVLVPCSHNSPEGI------LREQTQQLLDRYAREGLR 989

Mouse   844 TLCIAKKVVDEEDFQRWASFRREAEASLDNREELLMETAQHLENHLTLLGATGIEDRLQEGVPDT 908
            .|.:||:.::..|:..|.:..:|.|.||:|||..|.::...||::||||||||||||||:|||:|
  Fly   990 ILVMAKRTLNSADYTDWWARHQEIEMSLENRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPET 1054

Mouse   909 IAALREAGIQLWVLTGDKQETAVNIAYSCKLLDQTDTVYSINTENQETCESILNCTLEDIKRFHE 973
            ||:|..|||.:|||||||.|||:|||||.||..|...:..:...:::..|:.:|..|.|::....
  Fly  1055 IASLLSAGISVWVLTGDKPETAINIAYSAKLFTQQMELIRLTARSRDAAETAINFYLTDMENDKT 1119

Mouse   974 PQ-----QPARKLCGHRIPPKMPSVNSGAMAPEIGLVIDGKTLNAIF--QGKLENKFLELTQYCR 1031
            ..     |..||                   .:..||:|||||..|.  :.||...||.|::.|.
  Fly  1120 TSTLGYGQSLRK-------------------KQRALVVDGKTLTFILDPKSKLILPFLRLSKRCA 1165

Mouse  1032 SVLCCRSTPLQKSMIVKLVRDKLSVMTLSIGDGANDVSMIQAADIGIGISGQEGMQAVMSSDFAI 1096
            ||||||||||||:.:||:|:::|::.||:||||||||||||.||:|:||||||||||||::||.:
  Fly  1166 SVLCCRSTPLQKAYLVKVVKEELNLRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTL 1230

Mouse  1097 ARFSHLKKLLLVHGHWCYSRLARMVVYYFYKNVCYVNLLFWYQFFCGFSGSTMIDYWQMIFFNLF 1161
            .||.:|::|||.||:|||.||:||::|:||||..:|.|:||||.:|||||..|:|...::.:||.
  Fly  1231 PRFRYLERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLI 1295

Mouse  1162 FTSLPPIIFGVLDKDVSAETLLALPELYKSGQNSECYNLPTFWVSMADAFYQSLICFFIPYLTYR 1226
            ||||||:..||.||.|:.:.||..|.|||:|:....|....||:.:.||.||||:.||:....|.
  Fly  1296 FTSLPPLAIGVYDKRVAEDLLLKNPYLYKNGRLGVAYRPHDFWLILLDALYQSLVIFFVALCAYA 1360

Mouse  1227 GSDIDVFTFGTPINTISLTTILLHQAMEMKTWTVLHGLVLLGSFLMYFVVSLIYNATCVTCNSPT 1291
            .||:.::.|||.|....|...|:|.|:|:::|||||.|.::.|...:::.:::|::.|:.|....
  Fly  1361 ESDVGIWEFGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFYLFAIVYDSVCMNCFGVR 1425

Mouse  1292 NPYWVMERQLSDPTFYLICLLTPVVALLPRYFLLSLQGTYGKSLISKAQKIDKLPIDKRNLEIQN 1356
            :.|||:....:....:|:.:|:.|||:|||..|.::             :|...|.|...:.:|:
  Fly  1426 SSYWVIFVCFASAVHWLVIMLSTVVAVLPRLLLTTV-------------RISLCPDDSTKVILQS 1477

Mouse  1357 WRSKQRPAPA----SASASASA 1374
            .|.:.|....    |.|.|||:
  Fly  1478 KRERSRGEALLVTWSRSTSASS 1499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atp10bXP_017170094.1 None
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 31/50 (62%)
ATPase-Plipid 250..1473 CDD:273734 541/1356 (40%)
E1-E2_ATPase 302..>394 CDD:278548 41/92 (45%)
Cation_ATPase <880..965 CDD:289987 41/85 (48%)
HAD_like <1177..1240 CDD:304363 40/63 (63%)
PhoLip_ATPase_C 1223..1468 CDD:292829 104/258 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 993 1.000 Inparanoid score I302
Isobase 1 0.950 0 Normalized mean entropy S3083
OMA 1 1.010
OrthoDB 1 1.010 D37083at33208
OrthoFinder 1 1.000 FOG0000836
OrthoInspector 1 1.000 T616067
orthoMCL 1 0.900 OOG5_128792
Panther 1 1.100 O PTHR24092
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3512
TreeFam 1 0.960
1312.820

Return to query results.
Submit another query.