DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15306 and mapre1a

DIOPT Version :10

Sequence 1:NP_572618.1 Gene:CG15306 / 31961 FlyBaseID:FBgn0030191 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_956158.2 Gene:mapre1a / 334135 ZFINID:ZDB-GENE-030131-6067 Length:272 Species:Danio rerio


Alignment Length:140 Identity:64/140 - (45%)
Similarity:89/140 - (63%) Gaps:6/140 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NVTVTHNSLVQWSRGDILDWFNETLQCNLINIEQLCTGAAYCNLMHMLYPKLINLKRVKFFSNQE 72
            :.:||..:|   ||.|:|.|.||:||.|...|||||||||||:.|.||:|..:.||:|||.:..|
Zfish     7 STSVTSENL---SRHDMLTWINESLQMNHAKIEQLCTGAAYCHFMDMLFPSCLPLKKVKFQAKLE 68

  Fly    73 YEYVNNFKELQKAFNKVNVSLPAEVNDLIKGHRVENFKFAVWFRHFFNVNHTKDKCAGYDALVAR 137
            :||::|||.||.:|.|:.||....|:.|:||...:||:|..||:.||:.|:...:   ||.:.||
Zfish    69 HEYIHNFKLLQASFKKMGVSKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKE---YDPVAAR 130

  Fly   138 DHQNIGIGSS 147
            ..|:|....|
Zfish   131 QGQDIPTNQS 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15306NP_572618.1 CH 18..124 CDD:425596 54/105 (51%)
MSCRAMM_ClfA <185..346 CDD:468110
mapre1aNP_956158.2 BIM1 16..>259 CDD:227542 61/128 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.