DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15306 and ebp-3

DIOPT Version :10

Sequence 1:NP_572618.1 Gene:CG15306 / 31961 FlyBaseID:FBgn0030191 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_507528.1 Gene:ebp-3 / 180181 WormBaseID:WBGene00007062 Length:187 Species:Caenorhabditis elegans


Alignment Length:65 Identity:11/65 - (16%)
Similarity:27/65 - (41%) Gaps:15/65 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 FKELQKAFNKVNVSLPAEVNDLIKGHRVENFKFAVWFRHFFNVNHTKDKCAGYDALVARDHQNIG 143
            |.:|::...:|...|....|.:....:..:|        :|:...|.:       ::.:|:::||
 Worm   104 FNKLKEELEEVTRQLTESDNVIASLEKERDF--------YFSKLRTIE-------VICQDNESIG 153

  Fly   144  143
             Worm   154  153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15306NP_572618.1 CH 18..124 CDD:425596 7/44 (16%)
MSCRAMM_ClfA <185..346 CDD:468110
ebp-3NP_507528.1 EB1 128..166 CDD:460870 6/41 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.