DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gip and HYI

DIOPT Version :9

Sequence 1:NP_511106.1 Gene:Gip / 31960 FlyBaseID:FBgn0011770 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001317455.1 Gene:HYI / 81888 HGNCID:26948 Length:302 Species:Homo sapiens


Alignment Length:291 Identity:96/291 - (32%)
Similarity:160/291 - (54%) Gaps:42/291 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LKFAANLNFLFTERATSIAERIRLAHQNGFRAVEIPYPEGETSDVVS-AVKETGVVVSLVNL-AF 65
            |:|:|||::||.| .:.:..|:|.|..:||.|||:.:|..||.:.:: |.:|.|:.:.|:|. ..
Human     4 LRFSANLSWLFPE-LSGLPARVRAAGSSGFEAVEVAWPYAETPEALARAAREAGLRLVLINTPPG 67

  Fly    66 DKSDDQLRFGSTSVPGSEKLFRSQLDATIDFARQVNC--GK------------------------ 104
            |:...::..|  :|||.:..||..|:..:   |..:|  |:                        
Human    68 DQEKGEMGLG--AVPGRQAAFREGLEQAV---RSGHCLMGRKLSVPCKGAVARGGLVYLAAFLRL 127

  Fly   105 --IHLTAGLFKGGQE-----SDYTKTYTANLKIAADSLRASKMIGVIEPIN-KYAVPGYYMNSYS 161
              |||.||....|.:     ::....:..||:.||..|....::|::|||| :...|.|::::..
Human   128 DMIHLMAGRVPQGADRIAVKAEMEAVFLENLRHAAGVLAQEDLVGLLEPINTRITDPQYFLDTPQ 192

  Fly   162 KAAGILADVAADNIQLLADLYHLQHLHGNVSKTLEEYKALIGHFQIAQVPHRHEPDVSGELDYGF 226
            :||.||..|...|:||..|::|.|.:.||::..:.|:..::||.|:||||.|.||...|||::.:
Human   193 QAAAILQKVGRPNLQLQMDIFHWQIMDGNLTGNIREFLPIVGHVQVAQVPGRGEPSSPGELNFPY 257

  Fly   227 VFKALQEFGYDGWIGCEYKPKTTTVEGLGWV 257
            :|:.|::.||.|::||||:|:..|||||.|:
Human   258 LFQLLEDEGYKGFVGCEYQPRGDTVEGLSWL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GipNP_511106.1 OH-pyruv-isom 4..256 CDD:163190 94/287 (33%)
AP_endonuc_2 24..222 CDD:279585 69/233 (30%)
HYINP_001317455.1 Hyi 3..291 CDD:226149 96/291 (33%)
AP_endonuc_2 24..255 CDD:279585 71/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153086
Domainoid 1 1.000 114 1.000 Domainoid score I6098
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12824
Inparanoid 1 1.050 180 1.000 Inparanoid score I4011
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52228
OrthoDB 1 1.010 - - D1440394at2759
OrthoFinder 1 1.000 - - FOG0005694
OrthoInspector 1 1.000 - - oto88527
orthoMCL 1 0.900 - - OOG6_106707
Panther 1 1.100 - - LDO PTHR43489
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6107
SonicParanoid 1 1.000 - - X4089
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.