DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ipod and Y38E10A.17

DIOPT Version :9

Sequence 1:NP_001285081.1 Gene:Ipod / 31954 FlyBaseID:FBgn0030187 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_496700.1 Gene:Y38E10A.17 / 174897 WormBaseID:WBGene00012595 Length:586 Species:Caenorhabditis elegans


Alignment Length:144 Identity:49/144 - (34%)
Similarity:57/144 - (39%) Gaps:28/144 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ATFLSLLGGGGGGGGGGGSKTTYNV-----------IATPSSGGGGGGGGGG---GGGGGHGYSY 66
            |...|...||...||||.|....:|           .|.|...||||||.||   ||||..||  
 Worm   416 AAATSAANGGNNAGGGGSSAEVRSVGFGAQQFGGSQFARPIPAGGGGGGSGGYGAGGGGSGGY-- 478

  Fly    67 AQGGGGGHGYAQGHGYGHGHGGSPQIIKVILQEGQGYSNAGGSAGGIVSSEGHGY------SHGH 125
               |.||.|.|:.......:|.|...:|.:   |.|....|||.....|..|.||      :...
 Worm   479 ---GAGGAGGARNSASNGSYGSSANEVKSV---GFGAQQYGGSVFAKPSGTGGGYVSAGSSARKS 537

  Fly   126 GHGYASGHGSYGGQ 139
            |...|.|.|:.||:
 Worm   538 GESGAGGGGAGGGK 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IpodNP_001285081.1 DUF4766 89..232 CDD:292595 17/57 (30%)
Y38E10A.17NP_496700.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163641
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.