DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATPsyndelta and AT5G47030

Sequence 1:NP_001259397.1 Gene:ATPsyndelta FlyBaseID:FBgn0028342 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_199514.1 Gene:AT5G47030 AraportID:AT5G47030 Length:203 Species:Arabidopsis thaliana

Alignment Length:201 Identity:57/202 (28%)
Similarity:95/202 (47%) Gaps:56/202 (28%)


  Fly     3 FVKNARLL----AARGARLAQNRSYSDEMKLTFAAANKTFYDA---------------------- 41
            |.:.:|||    ||..::....|::|.|:..|.   :.||.:|                      
plant     2 FKQASRLLSRSVAAASSKSVTTRAFSTELPSTL---DSTFVEAWKKVAPNMDPPQTPSAFMKPRP 63

  Fly    42 ---------------------AVVRQID---VPSFSGSFGILAKHVPTLAVLKPGVVQVVE-NDG 81
                                 ...:::|   :|:.:|..|:|..||||:|.||||::.|.| .|.
plant    64 STPSSIPTKLTVNFVLPYTSELTGKEVDMVIIPASTGQMGVLPGHVPTIAELKPGIMSVHEGTDV 128

  Fly    82 KTLKFFVSSGSVTVNEDSSVQVLAEEAHNIEDIDANEARQLLAKYQSQLSSAGDDKAKAQAAIAV 146
            |  |:|:|||...::.:|...::|.||..::.||.::.::.||::|.:|:||..|..||:|.|.|
plant   129 K--KYFLSSGFAFLHANSVADIIAVEAVPLDHIDPSQVQKGLAEFQQKLASATTDLEKAEAQIGV 191

  Fly   147 EVAEAL 152
            ||..|:
plant   192 EVHSAI 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsyndeltaNP_001259397.1 F1-ATPase_delta 27..141 CDD:213395 42/161 (26%)
AT5G47030NP_199514.1 atpC 73..198 CDD:234796 44/128 (34%)
F1-ATPase_delta 73..196 CDD:213395 43/125 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H37514
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1286602at2759
OrthoInspector 1 1.000 T193737
orthoMCL 1 0.900 OOG5_127404
Panther 1 1.100 LDO PTHR13822
Phylome 1 0.910 0.667 Consistency score
76.920

Return to query results.
Submit another query.