DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATPsyndelta and ATP5F1D

Sequence 1:NP_001259397.1 Gene:ATPsyndelta FlyBaseID:FBgn0028342 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001001975.1 Gene:ATP5F1D HGNCID:837 Length:168 Species:Homo sapiens

Alignment Length:154 Identity:75/155 (48%)
Similarity:102/155 (66%) Gaps:1/155 (1%)


  Fly     4 VKNARLLAARGARLAQNRSYSDEMKLTFAAANKTFYDAAVVRQIDVPSFSGSFGILAKHVPTLAV 68
            |::||..|...|..|. .|..::|..|||:..:.|::.|.|||:|||:.:|:|||||.|||||.|
Human    16 VRHARAYAEAAAAPAA-ASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQV 79

  Fly    69 LKPGVVQVVENDGKTLKFFVSSGSVTVNEDSSVQVLAEEAHNIEDIDANEARQLLAKYQSQLSSA 133
            |:||:|.|...||.|.|:||||||:.||.|||||:|||||..::.:|...|:..|.|.|::|...
Human    80 LRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGT 144

  Fly   134 GDDKAKAQAAIAVEVAEALVKAAE 157
            .|:..:|:..|.:|..||||||.|
Human   145 ADEATRAEIQIRIEANEALVKALE 168

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsyndeltaNP_001259397.1 F1-ATPase_delta 27..141 CDD:213395 59/114 (52%)
ATP5F1DNP_001001975.1 F1-ATPase_delta 38..162 CDD:213395 62/124 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C198381649
eggNOG 1 0.900 E1_COG0355
Hieranoid 1 1.000
Homologene 1 1.000 H37514
Inparanoid 1 1.050 136 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004365
OrthoInspector 1 1.000 T1075420
orthoMCL 1 0.900 OOG5_127404
Panther 1 1.100 LDO PTHR13822
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R119
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.