DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsyndelta and atp5f1d

DIOPT Version :8

Sequence 1:NP_001259397.1 Gene:ATPsyndelta / 31950 FlyBaseID:FBgn0028342 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_956262.1 Gene:atp5f1d / 335709 ZFINID:ZDB-GENE-030131-7649 Length:159 Species:Danio rerio

Alignment Length:156 Identity:82/157 (52%)
Similarity:106/157 (68%) Gaps:5/157 (3%)


  Fly     7 ARLLAARGA-RLAQNRSYSD----EMKLTFAAANKTFYDAAVVRQIDVPSFSGSFGILAKHVPTL 66
            ||.|..|.| .|...|||:|    :|..|||:..:.|:..|.|:|||||:.:|:||||..|||||
Zfish     4 ARFLLRRAAPALRHARSYADAPSAQMSFTFASPTEVFFKEASVKQIDVPTLTGAFGILPAHVPTL 68

  Fly    67 AVLKPGVVQVVENDGKTLKFFVSSGSVTVNEDSSVQVLAEEAHNIEDIDANEARQLLAKYQSQLS 131
            .||:||||.|..:||.:.|:||||||||||.|||||:|||||..:|.:|...|:..|.|.||:|.
Zfish    69 QVLRPGVVTVFNDDGSSKKYFVSSGSVTVNADSSVQLLAEEAFPLESLDVAAAKANLEKAQSELV 133

  Fly   132 SAGDDKAKAQAAIAVEVAEALVKAAE 157
            ||.|:..:|:..|::|..||:|||.|
Zfish   134 SASDEATRAEVLISIEANEAIVKALE 159

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsyndeltaNP_001259397.1 F1-ATPase_delta 27..141 CDD:213395 64/114 (56%)
atp5f1dNP_956262.1 AtpC 27..158 CDD:223432 71/131 (54%)
F1-ATPase_delta 29..153 CDD:213395 67/124 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C198384168
eggNOG 1 0.900 E1_COG0355
Hieranoid 1 1.000
Homologene 1 1.000 H37514
Inparanoid 1 1.050 146 1.000 Inparanoid score I4334
OMA 1 1.010
OrthoDB 1 1.010 D1286602at2759
OrthoFinder 1 1.000 FOG0004365
OrthoInspector 1 1.000 T1054656
orthoMCL 1 0.900 OOG5_127404
Panther 1 1.100 LDO PTHR13822
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R119
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.