DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATPsyndelta and atp16

Sequence 1:NP_001259397.1 Gene:ATPsyndelta FlyBaseID:FBgn0028342 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_596259.2 Gene:atp16 PomBaseID:SPBC13E7.04 Length:167 Species:Schizosaccharomyces pombe

Alignment Length:138 Identity:47/139 (34%)
Similarity:81/139 (58%) Gaps:1/139 (1%)


  Fly    18 AQNRSYSDEMKLTFAAANKTFYDAAVVRQIDVPSFSGSFGILAKHVPTLAVLKPGVVQVVENDGK 82
            ||....::::.|:.|...:|.|:...|.|:|:|:..|..|||..|||.:..|||||:.|.:....
pombe    29 AQAVQKNEKLVLSMALPYQTIYEKVPVTQVDIPAEDGEMGILKDHVPMIQCLKPGVISVTDESSN 93

  Fly    83 TLKFFVSSGSVTVNEDSSVQVLAEEAHNIEDIDANEARQLLAKYQSQLSSAGDDKAKAQAAIAVE 147
            ..|:|:|.|.......:.:.:...||:.:||..::.|.|||.|::::::|: |:...|:||:.|.
pombe    94 KSKYFISGGFAVQQPSNELSITVPEAYKLEDFSSSVANQLLEKHKAEMNSS-DEGVAAEAAVRVS 157

  Fly   148 VAEALVKA 155
            |.|:||:|
pombe   158 VLESLVRA 165

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsyndeltaNP_001259397.1 F1-ATPase_delta 27..141 CDD:213395 37/114 (32%)
atp16NP_596259.2 AtpC 38..167 CDD:223432 45/130 (35%)
F1-ATPase_delta 40..153 CDD:213395 38/114 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H37514
Inparanoid 1 1.050 95 1.000 Inparanoid score I1673
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004365
OrthoInspector 1 1.000 T1125920
orthoMCL 1 0.900 OOG5_127404
Panther 1 1.100 LDO PTHR13822
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R119
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.