DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2990 and DNA2

Sequence 1:NP_727386.1 Gene:CG2990 FlyBaseID:FBgn0030170 Length:1100 Species:Drosophila melanogaster
Sequence 2:NP_012034.1 Gene:DNA2 SGDID:S000001207 Length:1522 Species:Saccharomyces cerevisiae

Alignment Length:1242 Identity:332/1243 (27%)
Similarity:547/1243 (44%) Gaps:255/1243 (21%)


  Fly    13 ENDNTDVTSSNPQKKFKEQLDFSSD--------------------EVENIDWGDNDDFDLALIAA 57
            |:.|......|.:.::....:||.|                    :::.::...:||.   .||.
Yeast   338 EDSNCQRIKKNEKIEYNSSDEFSDDSLIELLNETQTQVEPNTIEQDLDKVEKMVSDDL---RIAT 399

  Fly    58 MDSISNHRLELTKW-QRCEVVRL-------EQLPNRKGLKVHVKRI---SGGDPETADCQLLPPW 111
            ..::|.:.|..... .|..||||       .:||     |:..::|   ..|..|.:...:..||
Yeast   400 DSTLSAYALRAKSGAPRDGVVRLVIVSLRSVELP-----KIGTQKILECIDGKGEQSSVVVRHPW 459

  Fly   112 NCMPMQVGDTVSLL-GKWDPSAGCYVVDK-------EQGYCVSHPDFLISGTTVTGSLFCKRKSV 168
            ..:..:|||.:.:: ||...:......||       .....|.:||.|.|.|:|..|:.|.|:|:
Yeast   460 VYLEFEVGDVIHIIEGKNIENKRLLSDDKNPKTQLANDNLLVLNPDVLFSATSVGSSVGCLRRSI 524

  Fly   169 LQERF---RGLDSGNSVMVIGTLVHELLQKVLRQKLFDKK----HIQSALQEMLASSSLAHLL-- 224
            ||.:|   ||..|  .||.:|.:||||||..::.||...|    .|...|..:|.:.|.:.::  
Yeast   525 LQMQFQDPRGEPS--LVMTLGNIVHELLQDSIKYKLSHNKISMEIIIQKLDSLLETYSFSIIICN 587

  Fly   225 ----YASNLIQVEMEDHLMKFIDPIVS--------FVAQYVKGEPPSVLLPEVYRGQIHEICDIE 277
                |...|:..|..::::.|::..||        .::...:.:|.|          |..:.|||
Yeast   588 EEIQYVKELVMKEHAENILYFVNKFVSKSNYGCYTSISGTRRTQPIS----------ISNVIDIE 642

  Fly   278 ENLWVPQLGLKGKVDVSVKVKNQRQREEIIPLELKTGRASFSMEHKGQLLLYQLMHSAQGRDTQS 342
            ||:|.|..||||.:|.:|:...:..::.|:|||:|||: |.|:.::.|.|:|.|:.:.:......
Yeast   643 ENIWSPIYGLKGFLDATVEANVENNKKHIVPLEVKTGK-SRSVSYEVQGLIYTLLLNDRYEIPIE 706

  Fly   343 GLLLYL-KEGLLREVASGRNEQRDLLMLRNDLAYWLTREVAIPASKEDPLEQLPLPEPVYHHSAC 406
            ..|||. ::..:.:..|..:..:.:||.||.::.....::.....:.....:||   |:...|:|
Yeast   707 FFLLYFTRDKNMTKFPSVLHSIKHILMSRNRMSMNFKHQLQEVFGQAQSRFELP---PLLRDSSC 768

  Fly   407 GNCAYNTICSSFAQKDSSLQLSDSHPLKKLMPQLLEHLSEADHAYVQHWCGLLALEEQHNRQS-S 470
            .:|.....|                   .::.:|||..:..:...|:   |...:...|..|: :
Yeast   769 DSCFIKESC-------------------MVLNKLLEDGTPEESGLVE---GEFEILTNHLSQNLA 811

  Fly   471 HVRSFWTK--DPAEREKEGIAI--RHLKLVKG----------------QEVI---LEEGRYRQTL 512
            :.:.|:||  |...:|:..|..  :.|.|:.|                .||:   ..||.|....
Yeast   812 NYKEFFTKYNDLITKEESSITCVNKELFLLDGSTRESRSGRCLSGLVVSEVVEHEKTEGAYIYCF 876

  Fly   513 ELGEEADPSRDLSLSGFDLGEYVVIS-STSRLAVAAG---FI------VSIEARRLDLRL----- 562
            ......:.|:.:..|.....::|:|| ......:..|   ||      :|::.:.|:.||     
Yeast   877 SRRRNDNNSQSMLSSQIAANDFVIISDEEGHFCLCQGRVQFINPAKIGISVKRKLLNNRLLDKEK 941

  Fly   563 ---------ERDLSQ-----RYSEETFIIDKHDSQ---SFATFNFTNLGM-LLSEG-----ERFQ 604
                     |.:|.|     ..:..|:.|||:|.|   |.|.||..:|.: .:|.|     ||.:
Yeast   942 GVTTIQSVVESELEQSSLIATQNLVTYRIDKNDIQQSLSLARFNLLSLFLPAVSPGVDIVDERSK 1006

  Fly   605 ELRDIIVAKKPPEQHKVLPKIILTKGAP------------------ILLNLNKVQQNAALRALTT 651
            ..|.   .|:....:::|..:::...||                  ..||||  |:.|..:.:..
Yeast  1007 LCRK---TKRSDGGNEILRSLLVDNRAPKFRDANDDPVIPYKLSKDTTLNLN--QKEAIDKVMRA 1066

  Fly   652 SSHLLIKGLPGTGKTQTLVALVRLLHLLGKSVLITAQTHSAVDNLIMRLLPFGLPMMRLGSGSRI 716
            ..:.||.|:||||||..:..::::|...||.||:|:.|||||||::::|....:.:||||...::
Yeast  1067 EDYALILGMPGTGKTTVIAEIIKILVSEGKRVLLTSYTHSAVDNILIKLRNTNISIMRLGMKHKV 1131

  Fly   717 HKQLEEISEERLTKDCKTVEELEKALGQPSIVGVTCLGCGHPLF--QRRQFDYCIVDEATQVLQP 779
            |...::......:  .|:..:....:...|:|..||||....||  ..:.|||.|:|||:|:..|
Yeast  1132 HPDTQKYVPNYAS--VKSYNDYLSKINSTSVVATTCLGINDILFTLNEKDFDYVILDEASQISMP 1194

  Fly   780 TVLRPLIHCSKFVLVGDPEQLPPIVRSKEARQRGADETLFQRLDSE--KATAVLSLQYRMNKTIT 842
            ..|.||.:.::|::|||..||||:|::..||..|.:|:||:....:  ::.|.|:|||||...|.
Yeast  1195 VALGPLRYGNRFIMVGDHYQLPPLVKNDAARLGGLEESLFKTFCEKHPESVAELTLQYRMCGDIV 1259

  Fly   843 RLANELTYGGDLKCASDEVSGARFEVELLNEAPRWVQRALTTH--LEQAVTLINTGDCLERCQEF 905
            .|:|.|.|...|||.::||.....|:.:.....|:...:..:.  ||         |.||..::.
Yeast  1260 TLSNFLIYDNKLKCGNNEVFAQSLELPMPEALSRYRNESANSKQWLE---------DILEPTRKV 1315

  Fly   906 VYASQRLVDTCSS-IEQSFSEDKDEIRKLTSKKRVSKYTNYCEAGIVMHLLRYLLKSGYEASRIG 969
            |:.:   .|.|.. ||||   :||.|            ||:.||.:.:..:..:|.||.....||
Yeast  1316 VFLN---YDNCPDIIEQS---EKDNI------------TNHGEAELTLQCVEGMLLSGVPCEDIG 1362

  Fly   970 VIAPYRAQVELFKKLASKLDTD-LECNTVDQFQGRDKNLIIYSCSKTGGDFSDMERSREAEILED 1033
            |:..||||:.|.||:.:|...| ||..|.||||||||..||.|..:.....:.      ..:|::
Yeast  1363 VMTLYRAQLRLLKKIFNKNVYDGLEILTADQFQGRDKKCIIISMVRRNSQLNG------GALLKE 1421

  Fly  1034 QRRLTVAITRAKNKLILLGD-------------IKCLEQ----YGPFRQ-LFKH-IPDRCRLKLE 1079
            .||:.||:||||:|||::|.             :..||:    |...:. |:|: .|||.. .::
Yeast  1422 LRRVNVAMTRAKSKLIIIGSKSTIGSVPEIKSFVNLLEERNWVYTMCKDALYKYKFPDRSN-AID 1485

  Fly  1080 EGRMEFG 1086
            |.|...|
Yeast  1486 EARKGCG 1492

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2990NP_727386.1 Dna2 99..297 CDD:285859 65/227 (29%)
Cas4_I-A_I-B_I-C_I-D_II-B <283..415 CDD:294426 34/133 (26%)
TIGR00376 480..1069 CDD:273041 200/692 (29%)
P-loop_NTPase 636..859 CDD:304359 84/227 (37%)
AAA_12 815..1055 CDD:289832 83/259 (32%)
DNA2NP_012034.1 Dna2 444..662 CDD:285859 66/230 (29%)
DNA2 551..1481 CDD:224037 272/1006 (27%)
Cas4_I-A_I-B_I-C_I-D_II-B <641..>716 CDD:294426 28/76 (37%)
P-loop_NTPase 1051..1254 CDD:304359 76/207 (37%)
AAA_12 1229..1443 CDD:289832 83/247 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C162999271
eggNOG 1 0.900 E1_COG1112
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 304 1.000 Inparanoid score I490
Isobase 1 0.950 0 Normalized mean entropy S2517
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004933
OrthoInspector 1 1.000 T1136003
orthoMCL 1 0.900 OOG5_129631
Panther 1 1.100 LDO PTHR10887
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R324
TreeFam 1 0.960
1312.740

Return to query results.
Submit another query.