DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2990 and CG6204

Sequence 1:NP_727386.1 Gene:CG2990 FlyBaseID:FBgn0030170 Length:1100 Species:Drosophila melanogaster
Sequence 2:NP_651229.2 Gene:CG6204 FlyBaseID:FBgn0039165 Length:903 Species:Drosophila melanogaster

Alignment Length:1132 Identity:229/1133 (20%)
Similarity:399/1133 (35%) Gaps:361/1133 (32%)


  Fly    35 SSDEVENIDWGDNDDFDLALIAAMDSISNHRLELTKWQRCEVVRLEQLPNRKGLKVHVKRISGGD 99
            |||:    ||.|.|  :..|:..::. |...|||.|                            :
  Fly     3 SSDD----DWFDQD--ENKLLQGLEK-SLKSLELQK----------------------------N 32

  Fly   100 PETADCQLLPP--WNCMPMQVGDTVSLLGKWDPSAGCYVVDKEQGYCVSHPDFLISGTTVTGSL- 161
            .|..:|   ||  ..|.|.:||:                      |.:.|..|  |.|.:|.:| 
  Fly    33 EEYIEC---PPSERKCPPSEVGE----------------------YVMQHTRF--SLTELTNALK 70

  Fly   162 ----------FCKRKSVLQERFRGLDSGNSVMVIGTLVHELLQKVLRQKL--FDKKHI-----QS 209
                      ...::.:.:.:....|   :|..:|..| ::|..:...:|  ||:..:     |:
  Fly    71 MPAIDMFLYFLSDKRDLFENQVLATD---NVKRVGLFV-DVLWSLCELELGGFDEVFLSAFSRQT 131

  Fly   210 ALQEMLASSSLAHLLYASNLIQVEMEDHLMKFIDPIVSFVAQYVKGEPPSVLLPEVYRGQIHEIC 274
            ||.:.:           .||:|.:                |...|.:..|.|:            
  Fly   132 ALLDKI-----------KNLLQAK----------------AAVAKCDAESALI------------ 157

  Fly   275 DIEENLWV----PQLGLKGK-----VDVSVKVKNQRQREEIIPLELKTGRASFSMEHKGQLLLYQ 330
             :..:.|:    .:.||...     |::..|:....:.:.|..||..||  :||...||  |:|.
  Fly   158 -LSHSKWMLLRAHKHGLLSHQGYELVELYKKLAPSFKSDMIDGLEAFTG--NFSHNVKG--LIYP 217

  Fly   331 LMHSAQGRDTQSGLLLYLKEGLLRE-VASGRNEQRDLLMLRNDLAYWLTREVAIPASKEDPLEQL 394
            .:.:..|:|..........|||:.: |....|..|:|  ||.|....|...|....|..| :::|
  Fly   218 TLETLLGKDATKAPNEEEDEGLVSDKVVKYVNALRNL--LREDFLAPLVEFVQQLRSGTD-VDEL 279

  Fly   395 PLPEPVYHHSACGNCAYNTICSSFAQKDSSLQLSDSHPLKKLMPQLLEHLSEADHAYVQHWCGLL 459
                                      |...|..||.|  ..|.||.         |..|.. .|:
  Fly   280 --------------------------KQQGLLWSDVH--LTLNPQF---------ANAQRH-SLV 306

  Fly   460 ALEEQHNRQSSHVRSFWTKDPAEREKEGIAIRHLKLVKGQEVILEEGRYRQTLELGEEADPSRDL 524
            .|:.|..::|.:....|...    .|.|..:.....:...::||....|.:..:|.|:.      
  Fly   307 FLKVQFTKESKNAYKTWLNS----IKSGTLLCLTTSLAFDDLILASVGYTEPEKLKEDC------ 361

  Fly   525 SLSGFDLGEYVVISSTSRLAVAAGFIVSIEARRLDLRLERDLS----QRYSEETFIIDKHDSQSF 585
             ||...:.:|.:.::.:|..:.....|..|..   ||:...||    :::....:|:|  .....
  Fly   362 -LSVQIVKQYNIGNAYNRPLIMFQAPVFFEPY---LRVHNYLSTCSTEKFPMGRYIVD--GQMEI 420

  Fly   586 ATFNFTNLGMLLSEGERFQELRDIIVAKKPPEQHKVLPKIILTKGAPILLNLNKVQQNAALRALT 650
            ....:...|:.||     ..::...:.|.|.:.|                 ||:.|:.|...|| 
  Fly   421 PPPAYMKPGVKLS-----FNMKPFTLDKLPEDLH-----------------LNESQKTAFKEAL- 462

  Fly   651 TSSHLLIKGLPGTGKTQTLVALVRLLHLLGKS-----VLITAQTHSAVDNLIMRLLPFGLPMMRL 710
            .....:|:|.||||||...|.||..|....|:     :::...|::::|..::::..:...::|.
  Fly   463 CREFSIIQGPPGTGKTHLSVQLVNSLIQNAKALGTGPIIVLTYTNNSLDKFLVKISRYTQEILRF 527

  Fly   711 GSGSR-----------------IHKQLEEI----------------------------------S 724
            |:.||                 :..:|:.|                                  :
  Fly   528 GNQSRDPQISKFNLSTTIKPELVPPRLKRIWWLVNCEYKEKFRNLQGLYANFDGSEESYQDTLAA 592

  Fly   725 EERLTKDCKTVEEL----------EKALGQPSIVGVTCLGCGHPLFQRRQFDYCIVDEATQVLQP 779
            :|:|.:..:.:|.|          ||.|   ..:..||....:.||:..|....:.:||.::.:.
  Fly   593 QEKLNQVAERIETLRMVFQFFLAREKDL---LAMTTTCAARHNFLFRLLQSKCVLFEEAAEIQEA 654

  Fly   780 TVLRPLI-HCSKFVLVGDPEQLPPIVRSKEARQRGADETLFQRL-DSEKATAVLSLQYRMNKTIT 842
            .::..|. |....:||||.:||.|...|::..|    .:||:|| .:....:.|:|||||...|:
  Fly   655 HIVACLTPHTEHVILVGDHKQLQPFSGSRKVPQ----ISLFERLIVAGLPFSRLNLQYRMRSCIS 715

  Fly   843 RLANELTYGGDLKCASDEVSGARFEVELLNEAPRWVQRALTTHLEQAVTLINTGDCLERCQEFVY 907
            .|.....| .:|.| |:.|.... ::.|:::...:||.....|                      
  Fly   716 ELLVPSIY-DELLC-SESVKEYE-DIRLMSKNLYFVQHNQPEH---------------------- 755

  Fly   908 ASQRLVDTCSSIEQSFSEDKDEIRKLTSKKRVSKYTNYCEAGIVMHLLRYLL-KSGYEASRIGVI 971
                    |.| :.|..                   |..|||::..|..:|: |:.|:.|.|.::
  Fly   756 --------CMS-DMSIG-------------------NLYEAGVLAKLTEFLIQKAQYKHSDIVIL 792

  Fly   972 APYRAQVELFKK-LASKLDTDLECNTVDQFQGRDKNLIIYSCSKTGGDFSDMERSREAEILEDQR 1035
            :||..|:|..|. |.....:.::..:||.|||.:.|:::.|..::       ..|.....|....
  Fly   793 SPYNGQIECIKNALPQNYRSTVQVASVDSFQGLEANIVLLSLVRS-------NISGRIGFLRQAN 850

  Fly  1036 RLTVAITRAKNKLILLGDIKCLEQYGP 1062
            |:.||::||:..|.::|::..|:...|
  Fly   851 RVCVALSRARWALYIVGNVTILKDTFP 877

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2990NP_727386.1 Dna2 99..297 CDD:285859 38/227 (17%)
Cas4_I-A_I-B_I-C_I-D_II-B <283..415 CDD:294426 32/138 (23%)
TIGR00376 480..1069 CDD:273041 135/658 (21%)
P-loop_NTPase 636..859 CDD:304359 68/291 (23%)
AAA_12 815..1055 CDD:289832 56/243 (23%)
CG6204NP_651229.2 AAA_11 449..679 CDD:289831 51/251 (20%)
AAA_19 467..>513 CDD:289986 15/46 (33%)
UvrD_C_2 688..869 CDD:304668 56/241 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C115042415
eggNOG 1 0.900 E1_COG1112
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10887
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.