DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2990 and CG7504

Sequence 1:NP_727386.1 Gene:CG2990 FlyBaseID:FBgn0030170 Length:1100 Species:Drosophila melanogaster
Sequence 2:NP_001137907.1 Gene:CG7504 FlyBaseID:FBgn0035842 Length:1676 Species:Drosophila melanogaster

Alignment Length:1380 Identity:275/1381 (20%)
Similarity:466/1381 (34%) Gaps:479/1381 (35%)


  Fly    12 LENDNTDVTSSNPQKKFKEQLDFSSDEVENIDWGDNDDFDLALIAAMDSISNHRLELTKWQRCEV 76
            :||.....:.||.|   :||:..|.:|..||              ....|..::....|      
  Fly   469 MENMTETKSCSNRQ---REQIVASRNEPTNI--------------CPQKIETNKTSTRK------ 510

  Fly    77 VRLEQLPNRKGLKVHVKRISGGDPETADCQLLPPWNCMPMQVGDTVSLLGKWDPSAGCYVVDKEQ 141
             |.....:|..|....|.|........:    ||...:..:             |..||      
  Fly   511 -RFVSTTSRDELSTTSKEIKDAPKNNVE----PPKKMLRSR-------------SKSCY------ 551

  Fly   142 GYCVSHPDFLISGTTVTGSLFCKRKSVLQERFRGLDSGNSVMVIGTLVHELLQKVLRQK------ 200
               :..|..|....|       |.:..|::::..:|:....:::......:|....:.|      
  Fly   552 ---IDRPVELDEHIT-------KNEVPLKKKYESVDNSKEELIVTLEAPAMLTTPTKSKTQCVKK 606

  Fly   201 -----------LFDKKHIQSALQEMLASSSL---------------------AHLL------YAS 227
                       :..:..|:|...|...:..:                     |.||      |..
  Fly   607 KATQTRGRRKTIHSRDEIRSLTAEAEENKKISPAKQTNEEIPIPTKSPLKRNARLLNRSKSCYMD 671

  Fly   228 NLIQVEMEDHLMKFI-----------DPIVSFV-AQYVKGEPPSVL----LPEVYRGQIHEICDI 276
            .|:..|.||...|.|           |.:::|| .:..:|  |||:    ||: .||:       
  Fly   672 RLVISETEDPAKKVIKDISPTKSDTTDNVLNFVDVRQTRG--PSVIEAPSLPK-NRGK------- 726

  Fly   277 EENLWVPQLGLKGKVDVSVKVKNQ-RQREEIIPLELKTGRASFSMEHKGQLLLYQLMHSAQGRDT 340
                      |:| |...||||:: ..|:..|..:.:. .|.:..:.|.:....:.:...: |:.
  Fly   727 ----------LRG-VSAEVKVKDKVLDRQRFIDYQAEM-NAKWKQKPKDKKKEDEKLKECR-REA 778

  Fly   341 QSGLLLYLKEGLLREVASGRNEQRDLLMLRN-DLAYWLTREVAIPA--------SKEDPLEQLPL 396
            ...|....||...|...:.|.....:..::| :...:||:.|..||        :|..|.:.:|.
  Fly   779 LKKLSEKPKENSHRSTTNKRKNPTSVPTVQNTNRGGFLTKGVDGPAPKLAKTDNAKPPPKKPVPK 843

  Fly   397 PEPVYHHSACGNCAYNTICSSFAQKDSSLQLSDS---HPLKKLMPQLLEHL--SEADHAYVQHWC 456
            ..|.              ..:|:|:   ||.:|.   ||    .||....:  .||:.|..|..|
  Fly   844 QPPA--------------IETFSQQ---LQAADKAVLHP----QPQCSRPVERKEAELARNQRTC 887

  Fly   457 GLLALEEQ--HNRQSSHVRSFWTKDPAEREKEGIAIRHLKLVKG--------QEVI-LEEGRYRQ 510
            ..:...|.  :::::...:....|.......:.:.:..::.|||        :|.| |....||:
  Fly   888 NKVTFAEMELYHQKAEDSKKLQKKLRKVHFNDDVKVHCIERVKGASSKVQGRKECIKLRLSSYRE 952

  Fly   511 TLE-LGEEADPSRDLSLSGFDL----GEYVVISSTSRLAVAAGFI----------------VSIE 554
            ..| :..|..|..|:......:    .:::...|..  |||...:                :.:.
  Fly   953 RREWIRRENKPVNDIRQHSRSILKWANQWLKHGSVD--AVAEQDVLMPIPPEFDSFKNYREIFVP 1015

  Fly   555 ARRLDL--RLERDLSQRYSEETF---------------IIDKHDSQSFATFNFTNL---GMLLSE 599
            ..:|:|  .:|||.... ::.||               ::.:.:|:.|..|....|   |||...
  Fly  1016 LMKLELLSTIERDYKIN-NKNTFSVSLINVETQDMCYRLVTRVNSKPFGKFVLYTLYCCGMLKET 1079

  Fly   600 GERFQELRDII---------VAKKPPEQHKV---------------------------------- 621
            .....||:.:.         :.|:...:.|:                                  
  Fly  1080 FANLLELKFVSGNVFDLTFEILKQDISEEKLKNIKQLTARPVVDSLRVELGALSAVHQLRSSPLC 1144

  Fly   622 --------------LPKIILT-KGAPILLNLNKVQQNAALRAL------TTSSHLLIKGLPGTGK 665
                          |||...| ||..   .||:.|:|..|...      ...|..||:|.|||||
  Fly  1145 RRILKPTQTVNEVSLPKQPFTFKGCH---KLNEHQENIVLHTYQRIIDDLQPSLTLIQGPPGTGK 1206

  Fly   666 TQTLVAL-VRLLH-----LLGKSVLITAQTHSAVDNLI--------------MRLLPFGL----- 705
            ::.:..| ::.|:     .|.:.:||.|.:::|||:::              ..||.||:     
  Fly  1207 SRVISELCLQTLYGNAAKTLDRKILICAHSNTAVDHIVGLLGSVLRVMNRDQFHLLRFGMHEKMS 1271

  Fly   706 ----PMMRLGSGSRIHKQ-LEEISEER---LTK---DCKTVEELEKALGQPSIVGVTCL------ 753
                |.......::..:| |:.:|:|.   |.|   |.|  :|:::...:.::.....|      
  Fly  1272 HYSRPFSLEAHFNKAKEQKLQRVSKENAEILKKQHNDLK--DEIQQLKEKTNLTSTYLLQQLQQK 1334

  Fly   754 ---------GCGHPLFQRRQ------------------------------FDYCIVDEATQVLQP 779
                     ....||.||.:                              ||.||||||||..:|
  Fly  1335 EKKLQLISNQLSPPLTQREEFEISHMCVTRANIICTTLSSCVKLANYVDFFDICIVDEATQCTEP 1399

  Fly   780 TVLRPL-IHCSKFVLVGDPEQLPPIVRSKEARQRGADETLFQRLDSEKATAV------------- 830
            ..|.|: ...:..|||||.:|||.:|.||:|...|...::|.|:.....|.:             
  Fly  1400 WTLLPMRFGLTHMVLVGDMQQLPAVVLSKKAIDFGLSNSMFDRIQRSLQTQLDKPGSYHLMHTKL 1464

  Fly   831 --LSLQYRMNKTITRLANELTYGGDLKCASDEVSGARFEVELLNEAPRWVQRALTTHLEQAVTLI 893
              ||.||||:..|.|..|:..|                |.:|:|                     
  Fly  1465 FKLSTQYRMHPEICRWPNQYFY----------------EDQLIN--------------------- 1492

  Fly   894 NTGDCLERCQEFVYASQRLVDTCSSIEQSFSEDKDEIRKLTSKKRVSKYTNYCEAGIVMHLLRYL 958
              .:|..|     :||. |:..| .|...::.|.:.    ...|.:|   |..||..|..||..:
  Fly  1493 --AECTAR-----FASP-LIPYC-VINLKYTCDSNG----AQNKSIS---NNEEARFVAKLLTEM 1541

  Fly   959 LKSGYEASR---IGVIAPYRAQ-VELFKKLASKLDTDLECNTVDQFQGRDKNLIIYSCSKTGGDF 1019
            .|  :..|:   .|:|:||:.| ..|.:.:.|.:  ::...|||.:||.:|::||.|.::|.|  
  Fly  1542 DK--HMPSKRFSYGLISPYQNQCYALSQVIPSHM--NITPQTVDSYQGLEKDVIIISNARTRG-- 1600

  Fly  1020 SDMERSREAEILEDQRRLTVAITRAKNKLILLGDIKCLEQYGPFRQLFKHIPDRCRLKLEEGRME 1084
                    ...|.:.:||.||:||.:..|::.|:.:.|:....:|.|           |::.|..
  Fly  1601 --------CGFLTNYQRLNVALTRPRRCLVICGNFEDLKSVEMWRNL-----------LDDARKR 1646

  Fly  1085 FGWQRIQEDLVGLMD 1099
            ..:..:..|.|..:|
  Fly  1647 KVYFNLDRDDVNDLD 1661

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2990NP_727386.1 Dna2 99..297 CDD:285859 42/258 (16%)
Cas4_I-A_I-B_I-C_I-D_II-B <283..415 CDD:294426 27/142 (19%)
TIGR00376 480..1069 CDD:273041 172/804 (21%)
P-loop_NTPase 636..859 CDD:304359 81/326 (25%)
AAA_12 815..1055 CDD:289832 61/259 (24%)
CG7504NP_001137907.1 FHA 4..96 CDD:238017
FHA <10..101 CDD:224630
AAA_11 1171..1428 CDD:289831 65/259 (25%)
AAA_19 1194..1251 CDD:289986 18/57 (32%)
YtxH <1293..1347 CDD:295162 8/56 (14%)
AAA_12 1435..1626 CDD:289832 61/258 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C115066258
eggNOG 1 0.900 E1_COG1112
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10887
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.