DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and PNLIPRP1

DIOPT Version :8

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001290064.1 Gene:PNLIPRP1 / 5407 HGNCID:9156 Length:467 Species:Homo sapiens

Alignment Length:373 Identity:109/373 - (29%)
Similarity:162/373 - (43%) Gaps:83/373 - (22%)


  Fly    30 WSPMMKAFRYLQETMLR-NSLERAHLNHGIVFECRTISAKDFGNEVHFNLQLGDLRGFRRLDPNK 93
            |||.....|:|..|... |:.:...|:     :..||.|.:|                 ::|  :
Human    47 WSPEKIGTRFLLYTNENPNNFQILLLS-----DPSTIEASNF-----------------QMD--R 87

  Fly    94 KLALFLHGWNDQGSKDWVQELLLTWTLFD-SNYNVCVVDWGNLSQNDYKSASMSIFDVGLTVAGI 157
            |....:||:.|:|.:.||.::..  .||: ...|...|||...||..|..|:.::..||..||.:
Human    88 KTRFIIHGFIDKGDESWVTDMCK--KLFEVEEVNCICVDWKKGSQATYTQAANNVRVVGAQVAQM 150

  Fly   158 IMALEELRPNHFHRSNVTLAGYSLGAHAAGYAGAVLEGQVEQIIGLDPAGPLF-SLPAEVAPKYR 221
            :..|  |....:..|.|.|.|:|||||.||.||:...| :.:|.||||....| |.|.||    |
Human   151 LDIL--LTEYSYPPSKVHLIGHSLGAHVAGEAGSKTPG-LSRITGLDPVEASFESTPEEV----R 208

  Fly   222 LDPGDAQFVQVLHTSGGSL------GTSLKCGHADFYPNGGRAPQTNCK------------MFAN 268
            |||.||.||.|:||....|      ||:.:.||.||:||||.: ...||            ::|.
Human   209 LDPSDADFVDVIHTDAAPLIPFLGFGTNQQMGHLDFFPNGGES-MPGCKKNALSQIVDLDGIWAG 272

  Fly   269 LRDMQNTNPVSCSHSAAAIFFRQS-MDPEYPFVGYECGSYREFAAGYC----------DGNRKAR 322
            .||.     |:|:|..:..::.:| ::|: .|..|.|.||:.|.:..|          .|:...:
Human   273 TRDF-----VACNHLRSYKYYLESILNPD-GFAAYPCTSYKSFESDKCFPCPDQGCPQMGHYADK 331

  Fly   323 FGIHSQRRAQGSFYFRTAPQQPYVPRRQTNWLSGV-----GRMSSSKV 365
            |...:....| .|:..|.....:     ..|..||     ||.::.::
Human   332 FAGRTSEEQQ-KFFLNTGEASNF-----ARWRYGVSITLSGRTATGQI 373

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 94/304 (31%)
PNLIPRP1NP_001290064.1 Lipase 18..353 CDD:278576 104/346 (30%)
Pancreat_lipase_like 52..349 CDD:238363 101/337 (30%)
PLAT_PL 356..467 CDD:238857 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.