DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and liph

DIOPT Version :8

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001011098.1 Gene:liph / 496511 XenbaseID:XB-GENE-5847665 Length:460 Species:Xenopus tropicalis

Alignment Length:375 Identity:100/375 - (26%)
Similarity:154/375 - (41%) Gaps:78/375 - (20%)


  Fly     4 HVNHLLLLGCLLCLLGDVPRIEAFHRWSPMMKAFRYLQETMLRNSLERAHLNHGIVFECR--TIS 66
            :.|.||.:||||. .|.....|..|.::          :..:.||:....|...::...|  ...
 Frog     6 YFNGLLFVGCLLS-WGRSDTEEQCHTFT----------DLNIHNSIIGTGLKVQLLLYTRENPKC 59

  Fly    67 AKDFGNEVHFNLQLGDLRGFRRLDPNKKLALFLHGWNDQGSKD-WVQELLLTWTLFDSNYNVCVV 130
            |:|        |.:.:..||:.|:..::.....||:...||.. |:.:::..: |...::||.||
 Frog    60 AQD--------LNVDNSTGFQYLNVTRRTVFITHGYRPTGSPPVWIDDIVKKF-LDIQDFNVIVV 115

  Fly   131 DWG---------NLSQNDYKSASM------SIFDVGLTVAGIIMALEELRPNHFHRSNVTLAGYS 180
            ||.         |.:.|..|.|.:      ::...|.|:..|.|                 .|.|
 Frog   116 DWNRGATTVLYHNAAANTRKVADILKRFIDNMLSQGATLDSIYM-----------------VGVS 163

  Fly   181 LGAHAAGYAGAVLEGQVEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSGGSLGTSLK 245
            ||||.:|:.|.:..|.:.:|.|||||||||:   ...|:.||...|||||.|:|:....||....
 Frog   164 LGAHISGFVGKMYNGSIGRITGLDPAGPLFN---GKPPEERLHYTDAQFVDVVHSDTDGLGYKES 225

  Fly   246 CGHADFYPNGGRAPQTNCKMFANLRDMQNTNPVSCSHSAAAIFFRQSMDPEYPFVGYECGSYREF 310
            .||.||||||| ..|..|....    :..:....|.|..:...:..|:......|.:.|.|||::
 Frog   226 LGHIDFYPNGG-TDQPGCPKTI----LAGSEYFKCDHQRSVFLYIASLTKSCDLVAFPCKSYRDY 285

  Fly   311 AAGYCDGNRK------ARFGIHS--------QRRAQG-SFYFRTAPQQPY 345
            ..|.|...::      ...|.::        :|...| :.:|.||.:.||
 Frog   286 RIGNCTDCKEFLPLSCPVLGFYADKWKDHLVKRNHPGTTAFFDTAAKDPY 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 83/304 (27%)
liphNP_001011098.1 Pancreat_lipase_like 45..312 CDD:238363 81/300 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.