DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and lipia

DIOPT Version :8

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001003499.1 Gene:lipia / 445105 ZFINID:ZDB-GENE-040801-242 Length:454 Species:Danio rerio

Alignment Length:343 Identity:95/343 - (27%)
Similarity:146/343 - (42%) Gaps:68/343 - (19%)


  Fly    61 ECRTISAKDF-----GNEVHFNLQLGDLRGFRRLDPN------------------KKLALFL-HG 101
            ||..::..:|     |..:...|.|     :.|.||:                  ..:..|| ||
Zfish    25 ECEEMTDLNFKDSLAGTSLKVRLLL-----YTRADPSCGQLLSHQEPFSNSQFNVSSVTTFLIHG 84

  Fly   102 WNDQGSKD-WVQELLLTWTLFDSNYNVCVVDWGNLSQN-DYKSASMSIFDVGLTVAGIIMALEEL 164
            :...||.. |::: .:.:.|...:.||.||||...:.| :|.....:...|...:..:|   :::
Zfish    85 YRPTGSPPVWMKQ-FVEFLLNRRDMNVIVVDWNRGATNMNYWQVVKNTRKVANNLTDLI---QKM 145

  Fly   165 RPNHFHRSNVTLAGYSLGAHAAGYAGAVLEGQVEQIIGLDPAGPLFS-LPAEVAPKYRLDPGDAQ 228
            :.|..:.|::.:.|.|||||.:|:.||...|::.:|..||||||.|: .|    |:.||||.||.
Zfish   146 KDNGANLSSIHMIGVSLGAHISGFTGANFNGEIGRITALDPAGPEFNGRP----PEDRLDPSDAL 206

  Fly   229 FVQVLHTSGGSLGTSLKCGHADFYPNGGRAPQTNCKMFANLRDMQNTNPVSCSHSAAAIFFRQSM 293
            ||:.|||...:||.....||.|:|.||| |.|..|....    :..:....|.|..:...:..|:
Zfish   207 FVEALHTDMDALGYRNLLGHIDYYANGG-ADQPGCPKTI----LSGSEYFKCDHQRSVFLYMSSV 266

  Fly   294 DPEYPFVGYECGSYREFAAGYCDGNRKAR------FGIHSQR-------RAQGSFYFRTAPQQPY 345
            :...|.:.|.|.||.:|..|.|....|.:      ||..|.|       ..|...||:|....|:
Zfish   267 NGSCPIIAYPCESYTDFQDGTCMDCGKFKSAGCPIFGYDSVRWRDTLVQLEQTRTYFQTNKASPF 331

  Fly   346 VP----------RRQTNW 353
            ..          .::|:|
Zfish   332 CKVGYKVDIVSWNQKTHW 349

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 90/313 (29%)
lipiaNP_001003499.1 Pancreat_lipase_like 43..327 CDD:238363 88/301 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.