DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and Lipc

DIOPT Version :8

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_006510879.1 Gene:Lipc / 15450 MGIID:96216 Length:526 Species:Mus musculus

Alignment Length:299 Identity:93/299 - (31%)
Similarity:133/299 - (44%) Gaps:47/299 - (15%)


  Fly    85 GFRRLDPNKKLALFLHGWN---------DQGSKDWVQELLLTW---------TLFDSNYNVCVVD 131
            ||....|   |.:.:|||:         |..|...|..||..|         :......||.:||
Mouse    77 GFNSSQP---LIMIIHGWSGSESATVGKDSDSDYQVDGLLENWIWKIVSALKSRQSQPVNVGLVD 138

  Fly   132 WGNLSQNDYKSASMSIFDVGLTVAGIIMALEELRPNHFHRSNVTLAGYSLGAHAAGYAGAVLEG- 195
            |.:|:...|..|..:...||..||.:::.|||  ...|.||.|.|.|||||||.:|:||:.::| 
Mouse   139 WISLAYQHYTIAVQNTRIVGQDVAALLLWLEE--SAKFSRSKVHLIGYSLGAHVSGFAGSSMDGK 201

  Fly   196 -QVEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHT-----SGGSLGTSLKCGHADFYPN 254
             ::.:|.|||||||:|.   ..:|..||.|.||.||..:||     .|.|:|......|.|||||
Mouse   202 NKIGRITGLDPAGPMFE---GTSPNERLSPDDANFVDAIHTFTREHMGLSVGIKQPIAHYDFYPN 263

  Fly   255 GGRAPQTNCKMFANLRDMQN------TNPVSCSHSAAAIFFRQSMD-PEYPFVGYECGSYREFAA 312
            || :.|..|......:.:..      |..:.|:|..:...|..|:. .:...:|::|.....|:.
Mouse   264 GG-SFQPGCHFLELYKHIAEHGLNAITQTIKCAHERSVHLFIDSLQHSDLQSIGFQCSDMGSFSQ 327

  Fly   313 GYCDGNRKAR-----FGIHSQRRAQGS-FYFRTAPQQPY 345
            |.|...:|.|     :.|...|..:.. .:..|..|.|:
Mouse   328 GLCLSCKKGRCNTLGYDIRKDRSGKSKRLFLITRAQSPF 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 91/293 (31%)
LipcXP_006510879.1 Lipase 18..366 CDD:278576 92/297 (31%)
Pancreat_lipase_like 47..362 CDD:238363 91/293 (31%)
PLAT_LPL 369..504 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S7922
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.