DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and pnliprp3

DIOPT Version :8

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_017945500.1 Gene:pnliprp3 / 100487975 XenbaseID:XB-GENE-6250474 Length:453 Species:Xenopus tropicalis

Alignment Length:411 Identity:100/411 - (24%)
Similarity:150/411 - (36%) Gaps:124/411 - (30%)


  Fly    37 FRYLQETMLRNSLERAHLNHGIV----FECRT----------------------ISAK------- 68
            ||||.|.:..:.:.|.....|.|    ..|.|                      |:.:       
 Frog   109 FRYLMEELSMSEIWRHQHPRGSVCYGDLGCFTDEPPWGGTAERPLGLLPMSPEAINTRYFLVTRE 173

  Fly    69 --DFGNEV--HFNLQLGDLRGFRRLDPNKKLALFLHGWNDQGSKDWVQELLLTWTLFDSNYNVCV 129
              |:..|:  |.::...:.:      ||:|....:||:.:...:.|..|:.      ..||    
 Frog   174 NPDYFQEIISHSSVSTSNFK------PNRKTRFIIHGFVNTAERGWQMEMC------QKNY---- 222

  Fly   130 VDWGNLSQNDYKSASMSIFDVGLTVAGIIMALEELRPNHFHRSNVTLAGYSLGAHAAGYAGAVLE 194
                     ||.                        |:..|     :.|:|||||.||.||..:.
 Frog   223 ---------DYS------------------------PSMIH-----IIGHSLGAHVAGEAGKRVP 249

  Fly   195 GQVEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSGG------SLGTSLKCGHADFYP 253
            | :.:|.|||||||||.   ...|:.||||.||.||..:||...      .||.:...||.||:|
 Frog   250 G-IARISGLDPAGPLFQ---NTPPEVRLDPTDADFVDAIHTDTSPLIPKIGLGMAQSVGHLDFFP 310

  Fly   254 NGGRA-PQTNCKMFANLRDMQN-----TNPVSCSHSAAAIFFRQSMDPEYPFVGYECGSYREFAA 312
            |||:. |.....:...|.|::.     .|.::|:|..:..::.:|:.....||.:...:|..|..
 Frog   311 NGGQTMPGCGSNIITRLLDIEELWGGADNYLACNHLRSYKYYTESIRTPDAFVAFPSDTYEAFMK 375

  Fly   313 GY---CDGNRKARFGIHSQRRAQGS-----FYFRTAPQQPYVPRRQTNWLSGVGRMSSSKVSQVS 369
            |.   |........|.::....:|:     .|..|....||     ..|...|...:|..:|.:.
 Frog   376 GTGFPCPSTGCPLMGYYAGFYGRGTLSGLPLYLNTGDVSPY-----ARWRYKVTVKTSGTLSFMG 435

  Fly   370 QSPLVL-RLWTNSWRRRERAR 389
            ...:.| ||..||   :|.||
 Frog   436 DMKVTLHRLKRNS---KEIAR 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 75/304 (25%)
pnliprp3XP_017945500.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.