| Sequence 1: | NP_001188571.1 | Gene: | LysRS / 31904 | FlyBaseID: | FBgn0027084 | Length: | 607 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_014326.1 | Gene: | MSK1 / 855651 | SGDID: | S000005017 | Length: | 576 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 587 | Identity: | 191/587 - (32%) |
|---|---|---|---|
| Similarity: | 284/587 - (48%) | Gaps: | 109/587 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 78 SAAEEEEISPNEYFKLRSAAVQELKRSPATDPYPHKFHVSSSLEDFIAKY---------ENSLKE 133
Fly 134 GETLE-----NVKLSVAGRVHAIRESGAKLIFYDL--RGEGVK----VQVMAS----AKSYKSEA 183
Fly 184 DFEIDTSKLRRGDIIGVVGHPGKTKKGELSVMPSEIKLLSPCLHMLP--------HLHFGLKDKE 240
Fly 241 TRYRQRYLDLILNNNVREKFQIRAKIISYVRQFLDRLGFLEIETPMMNMIAGGATAKPFVTHHND 305
Fly 306 LKMDLFMRIAPELYHKMLVVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYADIMDIT 370
Fly 371 EQLVSGMVKAIRGSYKVIYHPEGPEGPEQELDFTP---PFKRVSMIKTLEEKLQVK--------- 423
Fly 424 -----------------FPAADTFNSPETNQFLSQLCAKHQVECPAPRTTARLLDKLVGEFIEE- 470
Fly 471 FCVN--PTFICEHPQIMSPLAKYHRSIPGLTERFELFVAKKEICNAYTELNDPVVQRERFEQQAS 533
Fly 534 -DKAAGDDEAQL---VDENFCTSLEYGLPPTGGFGMGIDRLAMFLTDSNNIKEVLLFPAMKPEDA 594
Fly 595 NR 596 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| LysRS | NP_001188571.1 | PLN02502 | 42..593 | CDD:215278 | 188/582 (32%) |
| LysRS_N | 141..250 | CDD:239817 | 35/126 (28%) | ||
| LysRS_core | 253..591 | CDD:238398 | 133/373 (36%) | ||
| MSK1 | NP_014326.1 | lysS_bact | 41..573 | CDD:273107 | 185/572 (32%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG1190 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S299 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR42918 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| 5 | 4.820 | |||||