DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LysRS and MSK1

Sequence 1:NP_001188571.1 Gene:LysRS FlyBaseID:FBgn0027084 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_014326.1 Gene:MSK1 SGDID:S000005017 Length:576 Species:Saccharomyces cerevisiae

Alignment Length:587 Identity:191/588 (32%)
Similarity:284/588 (48%) Gaps:109/588 (19%)


  Fly    78 SAAEEEEISPNEYFKLRSAAVQELKRSPATDPYPHKFHVSSSLEDFIAKY---------ENSLKE 133
            |.|...:.|..|..:.....|::|.|.     ||..  ..|:|.|...:|         |..|..
Yeast    30 SLAHAVDTSKMEATRRNGQIVKDLGRY-----YPSM--SESALHDLCQEYKEVTIADFNERFLGN 87

  Fly   134 GETLE-----NVKLSVAGRVHAIRESGAKLIFYDL--RGEGVK----VQVMAS----AKSYKSEA 183
            ..||.     |:.||:.||:.:||.||.|::|.||  ...|:|    :|::.:    ..|.:.:|
Yeast    88 PATLHHEDNPNLLLSINGRIKSIRFSGQKIVFIDLYNGSSGLKNDTQLQLIVNYNKIGGSSEDKA 152

  Fly   184 DFEIDTSKLRRGDIIGVVGHPGKTKKGELSVMPSEIKLLSPCLHMLP--------HLHFGLKDKE 240
            :|....:.|::||.|..:|:||.::        |.:|:||...:.||        .|...|.|:.
Yeast   153 NFSEYMNFLKKGDYIKALGYPGFSQ--------SRVKMLSLICNKLPIVLSVSQLPLPSRLNDET 209

  Fly   241 TRYRQRYLDLILNNNVREKFQIRAKIISYVRQFLDRLGFLEIETPMMNMIAGGATAKPFVTHHND 305
            .....|.:|..||..  :...:||:||..:|:|||...|:|:|||:::..:.||.||||:|...|
Yeast   210 KIKSNRVVDYQLNGT--QTLLVRARIIKLLRKFLDDRNFVEVETPILSSKSNGAMAKPFITSSKD 272

  Fly   306 LKMDLFMRIAPELYHKMLVVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYADIMDIT 370
            .. .|.:||||||:.|.|::.||.:|||||:.|||||||.|||.||:|.|||..|....||:..|
Yeast   273 FD-HLELRIAPELWLKRLIISGLQKVYEIGKVFRNEGIDSTHNAEFSTLEFYETYMSMDDIVTRT 336

  Fly   371 EQLVSGMVKAIRGSYKVIYHPEGPEGPEQELDFTP---PFKRVSMIKTLEEKLQVK--------- 423
            |.|...::..::..::....|......|..|..:.   .|::|..:.||.::|.:.         
Yeast   337 EDLFKFLITNLQKFFQDTRLPVPKTFSELHLALSENNWKFRKVEFLPTLNKELGIDLMNSGLDIN 401

  Fly   424 -----------------FPAADTFNSPETNQFLSQLCAKHQVECPAPRTTARLLDKLVGEFIEE- 470
                             ||:||     .|.| ||.|               ::|:||...|:|: 
Yeast   402 KPSELLKALPKDIAKKYFPSAD-----NTGQ-LSSL---------------QILNKLSDVFLEQR 445

  Fly   471 FCVN--PTFICEHPQIMSPLAKYHRSIPGLTERFELFVAKKEICNAYTELNDPVVQRERFEQQAS 533
            .|.:  ||.|...|.|:|||||.......:|:|||:|:..||..|||.|.|.|.:|.::|.||..
Yeast   446 HCQSTLPTVIYHQPAILSPLAKTDPQNKQVTKRFEVFIKGKEYINAYEEENCPQLQLQKFLQQKQ 510

  Fly   534 -DKAAGDDEAQL---VDENFCTSLEYGLPPTGGFGMGIDRLAMFLTDSNNIKEVLLFPAMKPEDA 594
             ::..|:....|   :|..:..:::||:||.||||:|||||.|...|...|:|||.|..:  :|.
Yeast   511 INELTGNKTETLSPVIDYQYVETMKYGMPPVGGFGLGIDRLCMLFCDKKRIEEVLPFGCV--DDV 573

  Fly   595 NR 596
            ||
Yeast   574 NR 575

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LysRSNP_001188571.1 PLN02502 42..593 CDD:215278 188/583 (32%)
LysRS_N 141..250 CDD:239817 36/127 (28%)
LysRS_core 253..591 CDD:238398 133/374 (36%)
MSK1NP_014326.1 lysS_bact 41..573 CDD:273107 186/573 (32%)
LysRS_N 101..219 CDD:239817 36/126 (29%)
class_II_aaRS-like_core 220..572 CDD:294192 134/378 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S299
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR42918
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.910

Return to query results.
Submit another query.