DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LysRS and Kars

Sequence 1:NP_001188571.1 Gene:LysRS FlyBaseID:FBgn0027084 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001124340.1 Gene:Kars MGIID:1934754 Length:624 Species:Mus musculus

Alignment Length:625 Identity:414/626 (66%)
Similarity:487/626 (78%) Gaps:37/626 (6%)


  Fly     1 MFARCALRTVQG-----SWPRCRYTGIQPLAAGFHVSAP-----QMEPSKQTKLELKRRLKAEQK 55
            |..:.|:|.|:|     ||..   .|.:.|..| |: ||     :.:|....:.|||||||||:|
Mouse     1 MLMQAAVRLVRGALRQTSWAE---WGQRELRLG-HL-APFTTLHKDQPLSDRRSELKRRLKAEKK 60

  Fly    56 AKEKAEK-----------AAAAP---AENTAGKKKSSAAEEEEISPNEYFKLRSAAVQELKRSPA 106
            ..||..|           .|:||   |:|..|      ||||.:.||:|:|:||.|||:||.: .
Mouse    61 LAEKEAKQKELSEKQLNQTASAPNHTADNGVG------AEEETLDPNQYYKIRSQAVQQLKVT-G 118

  Fly   107 TDPYPHKFHVSSSLEDFIAKYENSLKEGETLENVKLSVAGRVHAIRESGAKLIFYDLRGEGVKVQ 171
            .|||||||||..||..||.:|.: |:.|:.|.:|.|.||||:||.|.||.|||||||||||||:|
Mouse   119 EDPYPHKFHVDISLTQFIQEYSH-LQPGDHLTDVTLKVAGRIHAKRASGGKLIFYDLRGEGVKLQ 182

  Fly   172 VMASAKSYKSEADFEIDTSKLRRGDIIGVVGHPGKTKKGELSVMPSEIKLLSPCLHMLPHLHFGL 236
            |||::::||||.:|....:||||||||||.|:||||||||||::|.||.||||||||||||||||
Mouse   183 VMANSRNYKSEEEFVHINNKLRRGDIIGVEGNPGKTKKGELSIIPQEITLLSPCLHMLPHLHFGL 247

  Fly   237 KDKETRYRQRYLDLILNNNVREKFQIRAKIISYVRQFLDRLGFLEIETPMMNMIAGGATAKPFVT 301
            |||||||||||||||||:.||:||.:|:|||:|:|.|||.||||||||||||:|.|||.||||:|
Mouse   248 KDKETRYRQRYLDLILNDFVRQKFIVRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFIT 312

  Fly   302 HHNDLKMDLFMRIAPELYHKMLVVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYADI 366
            :||:|.|:|:||||||||||||||||:|||||||||||||||||||||||||||||||||||.|:
Mouse   313 YHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDL 377

  Fly   367 MDITEQLVSGMVKAIRGSYKVIYHPEGPEGPEQELDFTPPFKRVSMIKTLEEKLQVKFPAADTFN 431
            |:|||:::|||||:|.||||:.|||:||||...|:||||||:|:||::.||:.|.||.|....|.
Mouse   378 MEITEKMLSGMVKSITGSYKITYHPDGPEGQAYEVDFTPPFRRISMVEELEKALGVKLPETSLFE 442

  Fly   432 SPETNQFLSQLCAKHQVECPAPRTTARLLDKLVGEFIEEFCVNPTFICEHPQIMSPLAKYHRSIP 496
            :.||.:.|..:|....||||.|||||||||||||||:|..|::|||||:||||||||||:|||..
Mouse   443 TEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCISPTFICDHPQIMSPLAKWHRSKE 507

  Fly   497 GLTERFELFVAKKEICNAYTELNDPVVQRERFEQQASDKAAGDDEAQLVDENFCTSLEYGLPPTG 561
            ||||||||||.|||||||||||||||.||:.||:||..||||||||..:||||||:||||||||.
Mouse   508 GLTERFELFVMKKEICNAYTELNDPVRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTA 572

  Fly   562 GFGMGIDRLAMFLTDSNNIKEVLLFPAMKPEDANRTAAET 601
            |:|||||||.||||||||||||||||||||||...|||.|
Mouse   573 GWGMGIDRLTMFLTDSNNIKEVLLFPAMKPEDKKETAATT 612

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LysRSNP_001188571.1 PLN02502 42..593 CDD:215278 395/565 (70%)
LysRS_N 141..250 CDD:239817 85/109 (78%)
LysRS_core 253..591 CDD:238398 253/338 (75%)
KarsNP_001124340.1 PLN02502 42..604 CDD:215278 396/570 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C77781314
eggNOG 1 0.900 E1_COG1190
Hieranoid 1 1.000
Homologene 1 1.000 H4053
Inparanoid 1 1.050 806 1.000 Inparanoid score I484
Isobase 1 0.950 0 Normalized mean entropy S299
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004389
OrthoInspector 1 1.000 T1085532
orthoMCL 1 0.900 OOG5_126972
Panther 1 1.100 LDO PTHR42918
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1446
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.