DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LysRS and KRS1

Sequence 1:NP_001188571.1 Gene:LysRS FlyBaseID:FBgn0027084 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_010322.1 Gene:KRS1 SGDID:S000002444 Length:591 Species:Saccharomyces cerevisiae

Alignment Length:559 Identity:341/560 (61%)
Similarity:433/560 (77%) Gaps:15/560 (3%)


  Fly    42 TKLELKRRLKAEQ-KAKEKAEKAAAAPAENTAGKKKSSAAEEEEISPNEYFKLRSAAVQELKRSP 105
            :|.|||:|:|..| :||:.|:||||.|  ..|.|||:...  .::.|::||:.||..:|||:::.
Yeast    28 SKSELKKRIKQRQVEAKKAAKKAAAQP--KPASKKKTDLF--ADLDPSQYFETRSRQIQELRKTH 88

  Fly   106 ATDPYPHKFHVSSSLEDFIAKYENSLKEGETLENVKLSVAGRVHAIRESGAKLIFYDLRGEGVKV 170
            ..:|||||||||.|..:|:|||.: ||:||||...|:|:|||:||.||||:||.||.|.|:||:|
Yeast    89 EPNPYPHKFHVSISNPEFLAKYAH-LKKGETLPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEV 152

  Fly   171 QVMASAKSYKSEADFEIDTSKLRRGDIIGVVGHPGKTK-----KGELSVMPSEIKLLSPCLHMLP 230
            |:|:..:.|.....:|.|...|:||||:||.|:.|:|:     :||:||..|.::||:|||||||
Yeast   153 QLMSQLQDYCDPDSYEKDHDLLKRGDIVGVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCLHMLP 217

  Fly   231 HLHFGLKDKETRYRQRYLDLILNNNVREKFQIRAKIISYVRQFLDRLGFLEIETPMMNMIAGGAT 295
            ..|||.||:|||||:||||||:|.:.|.:|..|::||.|:|:|||:..|:|:||||||:||||||
Yeast   218 ADHFGFKDQETRYRKRYLDLIMNKDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGAT 282

  Fly   296 AKPFVTHHNDLKMDLFMRIAPELYHKMLVVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAY 360
            ||||:||||||.||::|||||||:.|.||||||||||||||||||||||:||||||||||||.||
Yeast   283 AKPFITHHNDLDMDMYMRIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAY 347

  Fly   361 ADYADIMDITEQLVSGMVKAIRGSYKVIYHPEGPEGP--EQELDFTPPFKRVSMIKTLEEKLQVK 423
            ||..|:||:||.:.|.|||.|.|||.:.|||: |..|  |.||:|:.|:||::||:.||:...||
Yeast   348 ADVYDLMDMTELMFSEMVKEITGSYIIKYHPD-PADPAKELELNFSRPWKRINMIEELEKVFNVK 411

  Fly   424 FPAADTFNSPETNQFLSQLCAKHQVECPAPRTTARLLDKLVGEFIEEFCVNPTFICEHPQIMSPL 488
            ||:.|..::.||.:||.::...:::|||.|.|.||:||||||| :|:.|:|||||..|||:||||
Yeast   412 FPSGDQLHTAETGEFLKKILVDNKLECPPPLTNARMLDKLVGE-LEDTCINPTFIFGHPQMMSPL 475

  Fly   489 AKYHRSIPGLTERFELFVAKKEICNAYTELNDPVVQRERFEQQASDKAAGDDEAQLVDENFCTSL 553
            |||.|..|||.||||:|||.|||||||||||||..||.|||:||..|..||||||||||.||.:|
Yeast   476 AKYSRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNAL 540

  Fly   554 EYGLPPTGGFGMGIDRLAMFLTDSNNIKEVLLFPAMKPE 592
            |||||||||:|.|||||||||||||.|:||||||.:||:
Yeast   541 EYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPD 579

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LysRSNP_001188571.1 PLN02502 42..593 CDD:215278 341/560 (61%)
LysRS_N 141..250 CDD:239817 63/114 (55%)
LysRS_core 253..591 CDD:238398 228/340 (67%)
KRS1NP_010322.1 PLN02502 24..579 CDD:215278 341/558 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C77799672
eggNOG 1 0.900 E1_COG1190
Hieranoid 1 1.000
Homologene 1 1.000 H4053
Inparanoid 1 1.050 669 1.000 Inparanoid score I98
Isobase 1 0.950 0 Normalized mean entropy S299
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004389
OrthoInspector 1 1.000 T1136906
orthoMCL 1 0.900 OOG5_126972
Panther 1 1.100 LDO PTHR42918
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1446
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.