DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LysRS and OVA5

Sequence 1:NP_001188571.1 Gene:LysRS FlyBaseID:FBgn0027084 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_187958.1 Gene:OVA5 AraportID:AT3G13490 Length:602 Species:Arabidopsis thaliana

Alignment Length:594 Identity:226/595 (38%)
Similarity:324/595 (54%) Gaps:58/595 (10%)


  Fly    39 SKQTKL----------ELKRRLKAEQKAKEKAEKAAAAPAENTAGKKKSSAAEEEEISPNEYFK- 92
            |..|:|          .|...|:....|...:..|..|.....:|:.:.||:.....|..|..: 
plant    22 SSSTRLATTIYGRRSYHLSPALRCASAASSSSSSATTAETSKPSGRNRRSASSSNSTSDREAIRS 86

  Fly    93 LRSAAVQELKRSPATDPYPHKFHVSSSLEDFIAKYENSLKEGETLENV--KLSVAGRVHAIRESG 155
            :|...|:|| |....:||.:|:..|.|.......|:: |..||..:|.  .:|:||||.|.|..|
plant    87 IRLKKVEEL-RGQGLEPYAYKWEKSHSANQLQEIYKH-LANGEESDNEIDCVSIAGRVVARRAFG 149

  Fly   156 AKLIFYDLRGEGVKVQVMASAKSYKSEADFEIDTSKLRRGDIIGVVGHPGKTKKGELSVMPSEIK 220
             ||.|..||.:...:|:... |...|:..||.....:..|||:|..|...:|:|||||:..:...
plant   150 -KLAFLTLRDDSGTIQLYCE-KERLSDDQFEQLKQFIDIGDILGASGSMKRTEKGELSICVNSFS 212

  Fly   221 LLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNNNVREKFQIRAKIISYVRQFLDRLGFLEIETP 285
            :|:..|..||..:.||.|.:.||||||:|:|.|..|.:.|:.||||:|.:|:.::..|:||:|||
plant   213 ILTKSLLPLPDKYHGLTDIDKRYRQRYVDMIANPEVADVFRRRAKIVSEIRKTVESFGYLEVETP 277

  Fly   286 MMNMIAGGATAKPFVTHHNDLKMDLFMRIAPELYHKMLVVGGLDRVYEIGRQFRNEGIDLTHNPE 350
            ::...||||.|:||||.||.|..||::|||.||:.|.::|||.::||||||.||||||...||||
plant   278 VLQGAAGGAEARPFVTFHNSLGRDLYLRIATELHLKRMLVGGFEKVYEIGRIFRNEGISTRHNPE 342

  Fly   351 FTTCEFYMAYADYADIMDITEQLVSGMVKAIRGSYKVIYHPEGPEGPEQELDFTPPFKRVSMIKT 415
            |||.|.|.||:||..:||:.|.:|:....|:.|...:.|     :|.|..|:  .|::|.:|...
plant   343 FTTIEMYEAYSDYHSMMDMAELIVTQCSMAVNGKLTIDY-----QGTEICLE--RPWRRETMHNL 400

  Fly   416 LEEKLQVKFP--AADTFNSPETNQFLSQLCAKHQVECPAPRTTAR-------LLDKLVGEFIEEF 471
            ::|...:.|.  ..|..|:.:|     .|.|...|..|..::..|       ||:::....:|..
plant   401 VKEITGINFSELGEDLGNAKDT-----VLLALQDVLEPKDKSGIRACSSLGHLLNEIFEVVVEPK 460

  Fly   472 CVNPTFICEHPQIMSPLAKYHRSIPGLTERFELFVAKKEICNAYTELNDPVVQRERFEQQA---- 532
            .|.|||:.::|..:|||||.||...|||||||||:..:|:.||::||.|||.||.|.|:|.    
plant   461 LVQPTFVLDYPIEISPLAKPHRGNAGLTERFELFICGREMANAFSELTDPVDQRTRLEEQVRQHN 525

  Fly   533 --------------SDKAAGDDEAQLV--DENFCTSLEYGLPPTGGFGMGIDRLAMFLTDSNNIK 581
                          :.|...|||:..|  ||:|.|:||||:||..|.|:|||||.|.||:|.:|:
plant   526 AKRAEAVRESPEPNAKKDDDDDESYEVTLDEDFLTALEYGMPPASGMGLGIDRLVMLLTNSASIR 590

  Fly   582 EVLLFPAMK 590
            :|:.||.:|
plant   591 DVIAFPVLK 599

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LysRSNP_001188571.1 PLN02502 42..593 CDD:215278 225/592 (38%)
LysRS_N 141..250 CDD:239817 43/109 (39%)
LysRS_core 253..591 CDD:238398 154/368 (42%)
OVA5NP_187958.1 lysS 87..599 CDD:234778 212/528 (40%)
LysRS_N 136..242 CDD:239817 43/108 (40%)
LysRS_core 245..599 CDD:238398 153/366 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D837479at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126972
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.