DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LysRS and ATKRS-1

Sequence 1:NP_001188571.1 Gene:LysRS FlyBaseID:FBgn0027084 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_187777.1 Gene:ATKRS-1 AraportID:AT3G11710 Length:626 Species:Arabidopsis thaliana

Alignment Length:620 Identity:340/621 (55%)
Similarity:427/621 (69%) Gaps:52/621 (8%)


  Fly    12 GSWPRCRYTGIQPLAAGFHVSAPQMEPSKQTKLELKRRLKAEQKAKEKAEKAAAAPAENTAGKKK 76
            |:.||.:             :|.:.|...:.|.|.|||     |.:||||||..||   .|..:|
plant    33 GAGPRSK-------------NALKKEQKMKQKEEEKRR-----KDEEKAEKAKQAP---KASSQK 76

  Fly    77 SSAAEEEEISPNEYF--KLRSAAVQELKRSPATDPYPHKFHVSSSLEDFIAKYENSLKEGETLEN 139
            :.||::||:...:|:  :|:..|.::.|   ..:||||||.||.|:..:|..| .||..|:.:||
plant    77 AVAADDEEMDATQYYENRLKYLAAEKAK---GENPYPHKFAVSMSIPKYIETY-GSLNNGDHVEN 137

  Fly   140 VKLSVAGRVHAIRESGAKLIFYDLRGEGVKVQVMASA-KSYKSEADFEIDTSKLRRGDIIGVVGH 203
            .:.|:|||:.:.|.|.:||.||||.|:..||||||.| ||...||:|....|..:||||:||:|.
plant   138 AEESLAGRIMSKRSSSSKLFFYDLHGDDFKVQVMADASKSGLDEAEFLKLHSNAKRGDIVGVIGF 202

  Fly   204 PGKTKKGELSVMPSEIKLLSPCLHMLPHL---------------------HFGLKDKETRYRQRY 247
            |||||:||||:.|....|||.||||:|..                     .:.|||:|:|||||:
plant   203 PGKTKRGELSIFPRSFILLSHCLHMMPRKADNVNAKKPEIWVPGQTRNPEAYVLKDQESRYRQRH 267

  Fly   248 LDLILNNNVREKFQIRAKIISYVRQFLDRLGFLEIETPMMNMIAGGATAKPFVTHHNDLKMDLFM 312
            ||:|||..||:.|:.|||||||||:|||...|||:||||||||||||.|:|||||||||.|.|:|
plant   268 LDMILNVEVRQIFRTRAKIISYVRRFLDNKNFLEVETPMMNMIAGGAAARPFVTHHNDLDMRLYM 332

  Fly   313 RIAPELYHKMLVVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYADIMDITEQLVSGM 377
            |||||||.|.|:||||:||||||:|||||||||||||||||||||||:|||.|:|::||.::|||
plant   333 RIAPELYLKQLIVGGLERVYEIGKQFRNEGIDLTHNPEFTTCEFYMAFADYNDLMEMTEVMLSGM 397

  Fly   378 VKAIRGSYKVIYHPEGPEGPEQELDFTPPFKRVSMIKTLEEKLQVKFPAADTFNSPETNQFLSQL 442
            ||.:.|.||:.|:..|.:....|:||||||:|:.||..||:..::..|  ....|.|.|::|...
plant   398 VKELTGGYKIKYNANGYDKDPIEIDFTPPFRRIEMIGELEKVAKLNIP--KDLASEEANKYLIDA 460

  Fly   443 CAKHQVECPAPRTTARLLDKLVGEFIEEFCVNPTFICEHPQIMSPLAKYHRSIPGLTERFELFVA 507
            ||:..|:||.|:|||||||||||||:|..|||||||...|:|||||||:|||..|||||||||:.
plant   461 CARFDVKCPPPQTTARLLDKLVGEFLEPTCVNPTFIINQPEIMSPLAKWHRSKSGLTERFELFIN 525

  Fly   508 KKEICNAYTELNDPVVQRERFEQQASDKAAGDDEAQLVDENFCTSLEYGLPPTGGFGMGIDRLAM 572
            |.|:||||||||||||||:||..|..|:.:|||||..:||.||.:|||||.||||:|:|||||:|
plant   526 KHELCNAYTELNDPVVQRQRFADQLKDRQSGDDEAMALDETFCNALEYGLAPTGGWGLGIDRLSM 590

  Fly   573 FLTDSNNIKEVLLFPAMKPEDANRTAAETAPTAQQ 607
            .||||.||||||.||||:|......||: ||..::
plant   591 LLTDSLNIKEVLFFPAMRPPQEESAAAQ-APLTEE 624

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LysRSNP_001188571.1 PLN02502 42..593 CDD:215278 331/575 (58%)
LysRS_N 141..250 CDD:239817 62/131 (47%)
LysRS_core 253..591 CDD:238398 226/338 (67%)
ATKRS-1NP_187777.1 PLN02502 30..611 CDD:215278 336/605 (56%)
LysRS_N 141..270 CDD:239817 62/129 (48%)
LysRS_core 273..609 CDD:238398 226/338 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H4053
Inparanoid 1 1.050 635 1.000 Inparanoid score I186
OMA 1 1.010
OrthoDB 1 1.010 D837479at2759
OrthoInspector 1 1.000 T192737
orthoMCL 1 0.900 OOG5_126972
Panther 1 1.100 LDO PTHR42918
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.