DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LysRS and kars

Sequence 1:NP_001188571.1 Gene:LysRS FlyBaseID:FBgn0027084 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_012816251.1 Gene:kars XenbaseID:XB-GENE-943468 Length:605 Species:Xenopus tropicalis

Alignment Length:563 Identity:395/564 (70%)
Similarity:467/564 (83%) Gaps:7/564 (1%)


  Fly    43 KLELKRRLKAEQKAKEKAEKAAAAPAENTAGKKKSSAAEEEEISPNEYFKLRSAAVQELKRSPAT 107
            |.|.|||||||:||   .||.|....:|.....:.:|.:||.:.||:|||:|:.|:|:|| ....
 Frog    45 KSEQKRRLKAEKKA---TEKEAKHKEQNEKLHTEEAAIDEETLDPNQYFKIRTQAIQQLK-GTKD 105

  Fly   108 DPYPHKFHVSSSLEDFIAKYENSLKEGETLENVKLSVAGRVHAIRESGAKLIFYDLRGEGVKVQV 172
            ||||||:||..||.::|.|| |:|:.|:.|..| :|:|||:||.|.||||||||||||||.|:||
 Frog   106 DPYPHKYHVDMSLTEYIQKY-NNLQTGDQLSEV-VSIAGRIHAKRISGAKLIFYDLRGEGTKLQV 168

  Fly   173 MASAKSYKSEADFEIDTSKLRRGDIIGVVGHPGKTKKGELSVMPSEIKLLSPCLHMLPHLHFGLK 237
            ||:::.||||.:|....:||||||:|||.|:||||||||||::|.|:.|||||||||||||||||
 Frog   169 MANSRFYKSEEEFATINNKLRRGDLIGVKGNPGKTKKGELSIIPHEMILLSPCLHMLPHLHFGLK 233

  Fly   238 DKETRYRQRYLDLILNNNVREKFQIRAKIISYVRQFLDRLGFLEIETPMMNMIAGGATAKPFVTH 302
            ||||||||||||||||:.||:||.:|||:|:|:|:|||.||||||||||||:|.|||.||||:|:
 Frog   234 DKETRYRQRYLDLILNDYVRQKFIVRAKLITYLRKFLDDLGFLEIETPMMNVIPGGAVAKPFITY 298

  Fly   303 HNDLKMDLFMRIAPELYHKMLVVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYADIM 367
            ||:|.|.|:||||||||||||||||:|||||||||||||||||||||||||||||||||||.|:|
 Frog   299 HNELDMKLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYNDLM 363

  Fly   368 DITEQLVSGMVKAIRGSYKVIYHPEGPEGPEQELDFTPPFKRVSMIKTLEEKLQVKFPAADTFNS 432
            :|||:|:|||||.|.|.||||||||||||||.|:||||||:|:||:..||:.|..|.||.|.|::
 Frog   364 EITEKLLSGMVKHITGGYKVIYHPEGPEGPEYEIDFTPPFRRISMVHELEKALGKKLPATDQFDT 428

  Fly   433 PETNQFLSQLCAKHQVECPAPRTTARLLDKLVGEFIEEFCVNPTFICEHPQIMSPLAKYHRSIPG 497
            .||.:.|..:|.:.:||||||||||||||||||:|:|..|:|||:||:||||||||||:|||..|
 Frog   429 EETRKLLDDICVEKEVECPAPRTTARLLDKLVGDFLEVTCINPTYICDHPQIMSPLAKWHRSEKG 493

  Fly   498 LTERFELFVAKKEICNAYTELNDPVVQRERFEQQASDKAAGDDEAQLVDENFCTSLEYGLPPTGG 562
            |||||||||.|||||||||||||||.|||.||.||..||||||||..:||.|||:||||||||.|
 Frog   494 LTERFELFVMKKEICNAYTELNDPVRQRELFEDQAKAKAAGDDEAMFIDETFCTALEYGLPPTAG 558

  Fly   563 FGMGIDRLAMFLTDSNNIKEVLLFPAMKPEDANRTAAETAPTA 605
            :||||||:||||||||||||||||||||||| |:....:.|.:
 Frog   559 WGMGIDRVAMFLTDSNNIKEVLLFPAMKPED-NKKDPNSTPNS 600

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LysRSNP_001188571.1 PLN02502 42..593 CDD:215278 392/550 (71%)
LysRS_N 141..250 CDD:239817 82/109 (75%)
LysRS_core 253..591 CDD:238398 259/338 (77%)
karsXP_012816251.1 Peptidase_S49_N <20..>71 CDD:285669 15/29 (52%)
PLN02502 44..589 CDD:215278 392/550 (71%)
LysRS_N 138..246 CDD:239817 82/108 (76%)
LysRS_core 249..587 CDD:238398 259/338 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C77783270
eggNOG 1 0.900 E1_COG1190
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H4053
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D258797at33208
OrthoFinder 1 1.000 FOG0004389
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.