DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment LysRS and AT3G30805

DIOPT Version :9

Sequence 1:	NP_001188571.1	Gene:	LysRS / 31904	FlyBaseID:	FBgn0027084	Length:	607	Species:	Drosophila melanogaster
Sequence 2:	NP_001154656.1	Gene:	AT3G30805 / 3769140	AraportID:	AT3G30805	Length:	166	Species:	Arabidopsis thaliana

Alignment Length:	64	Identity:	38/64 - (59%)
Similarity:	46/64 - (71%)	Gaps:	1/64 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   533 SDKAAGDDEAQLVDENFCTSLEYGLPPTGGFGMGIDRLAMFLTDSNNIK-EVLLFPAMKPEDAN 595
            :|:.:|||||..:||.||.:||||||||||:||||||..|.||||.||| .:..||....|.:|
plant    70 TDRQSGDDEAMAMDETFCMALEYGLPPTGGWGMGIDRPLMLLTDSQNIKVPLFFFPEASLEKSN 133

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
LysRS	NP_001188571.1	PLN02502	42..593	CDD:215278	36/60 (60%)
		LysRS_N	141..250	CDD:239817
		LysRS_core	253..591	CDD:238398	36/58 (62%)
AT3G30805	NP_001154656.1	class_II_aaRS-like_core	<71..123	CDD:294192	34/51 (67%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1190
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810