DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LysRS and AT3G30805

Sequence 1:NP_001188571.1 Gene:LysRS FlyBaseID:FBgn0027084 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001154656.1 Gene:AT3G30805 AraportID:AT3G30805 Length:166 Species:Arabidopsis thaliana

Alignment Length:64 Identity:38/65 (58%)
Similarity:46/65 (71%) Gaps:1/65 (2%)


  Fly   533 SDKAAGDDEAQLVDENFCTSLEYGLPPTGGFGMGIDRLAMFLTDSNNIK-EVLLFPAMKPEDAN 595
            :|:.:|||||..:||.||.:||||||||||:||||||..|.||||.||| .:..||....|.:|
plant    70 TDRQSGDDEAMAMDETFCMALEYGLPPTGGWGMGIDRPLMLLTDSQNIKVPLFFFPEASLEKSN 133

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LysRSNP_001188571.1 PLN02502 42..593 CDD:215278 37/61 (61%)
LysRS_N 141..250 CDD:239817
LysRS_core 253..591 CDD:238398 36/59 (61%)
AT3G30805NP_001154656.1 class_II_aaRS-like_core <71..123 CDD:294192 34/52 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR42918
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.