DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LysRS and kars

Sequence 1:NP_001188571.1 Gene:LysRS FlyBaseID:FBgn0027084 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001002386.1 Gene:kars ZFINID:ZDB-GENE-021115-8 Length:602 Species:Danio rerio

Alignment Length:569 Identity:398/570 (70%)
Similarity:470/570 (82%) Gaps:6/570 (1%)


  Fly    40 KQTKLELKRRLKAEQKAKEKAEKAAAAPAE---NTAGKKKSSAAEEEEISPNEYFKLRSAAVQEL 101
            |..|.|||||:|||:||.||..|......:   |...::.:..|:||.:.||:|||:||.|:|.|
Zfish    36 KSDKSELKRRMKAEKKAAEKEAKVKEQQEQKETNDKPQQNAYGADEETLDPNQYFKIRSQAIQAL 100

  Fly   102 KRSPATDPYPHKFHVSSSLEDFIAKYENSLKEGETLENVKLSVAGRVHAIRESGAKLIFYDLRGE 166
            | ..|.|||||||||..||.:||.:| |.|:.|:.|.:|.|:::|||||.|.|||||:|||||||
Zfish   101 K-GTAEDPYPHKFHVDLSLTEFIERY-NHLQPGDHLTDVVLNLSGRVHAKRASGAKLLFYDLRGE 163

  Fly   167 GVKVQVMASAKSYKSEADFEIDTSKLRRGDIIGVVGHPGKTKKGELSVMPSEIKLLSPCLHMLPH 231
            |||:||||::::|.||..|....:||||||||||.|:||||||||||::|.|:.|||||||||||
Zfish   164 GVKLQVMANSRNYTSEEAFVHINNKLRRGDIIGVRGNPGKTKKGELSIIPVEMTLLSPCLHMLPH 228

  Fly   232 LHFGLKDKETRYRQRYLDLILNNNVREKFQIRAKIISYVRQFLDRLGFLEIETPMMNMIAGGATA 296
            |||||||||||:||||||||||:.||:||..|:|||:|:|.|||:||||||||||||:|.|||.|
Zfish   229 LHFGLKDKETRFRQRYLDLILNDFVRQKFVTRSKIITYLRSFLDQLGFLEIETPMMNLIPGGAVA 293

  Fly   297 KPFVTHHNDLKMDLFMRIAPELYHKMLVVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYA 361
            |||:|:||||.|:|:||||||||||||||||:|||||||||||||||||||||||||||||||||
Zfish   294 KPFITYHNDLNMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYA 358

  Fly   362 DYADIMDITEQLVSGMVKAIRGSYKVIYHPEGPEGPEQELDFTPPFKRVSMIKTLEEKLQVKFPA 426
            ||.|:|:|||:|:|||||.|.|:|||.|||:||||...|:||||||:|:||.:.||::|.||||.
Zfish   359 DYHDLMEITEKLLSGMVKHITGAYKVTYHPDGPEGQAYEIDFTPPFRRISMTQELEKELGVKFPP 423

  Fly   427 ADTFNSPETNQFLSQLCAKHQVECPAPRTTARLLDKLVGEFIEEFCVNPTFICEHPQIMSPLAKY 491
            .||::|.|..:||..||.:.:||||.|||||||||||||:|:|..|:|||:||:||||||||||:
Zfish   424 PDTYDSDEMRKFLDDLCVQKEVECPPPRTTARLLDKLVGDFLEVKCINPTYICDHPQIMSPLAKW 488

  Fly   492 HRSIPGLTERFELFVAKKEICNAYTELNDPVVQRERFEQQASDKAAGDDEAQLVDENFCTSLEYG 556
            |||..||||||||||.||||||||||||||:.|||.|||||..||.|||||..:||.|||:||||
Zfish   489 HRSQKGLTERFELFVMKKEICNAYTELNDPIRQRELFEQQAKAKAEGDDEAMFIDETFCTALEYG 553

  Fly   557 LPPTGGFGMGIDRLAMFLTDSNNIKEVLLFPAMKPEDANRTAAETAPTA 605
            ||||.|:|||||||.|||||||||||||||||||||| |:.||....|:
Zfish   554 LPPTAGWGMGIDRLTMFLTDSNNIKEVLLFPAMKPED-NKPAAPAEGTS 601

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LysRSNP_001188571.1 PLN02502 42..593 CDD:215278 392/554 (71%)
LysRS_N 141..250 CDD:239817 81/109 (74%)
LysRS_core 253..591 CDD:238398 257/338 (76%)
karsNP_001002386.1 PLN02502 34..590 CDD:215278 393/556 (71%)
LysRS_N 139..247 CDD:239817 81/108 (75%)
LysRS_core 250..588 CDD:238398 257/338 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C77782419
eggNOG 1 0.900 E1_COG1190
Hieranoid 1 1.000
Homologene 1 1.000 H4053
Inparanoid 1 1.050 803 1.000 Inparanoid score I462
OMA 1 1.010
OrthoDB 1 1.010 D258797at33208
OrthoFinder 1 1.000 FOG0004389
OrthoInspector 1 1.000 T1054659
orthoMCL 1 0.900 OOG5_126972
Panther 1 1.100 LDO PTHR42918
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1446
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.