DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LysRS and krs1

Sequence 1:NP_001188571.1 Gene:LysRS FlyBaseID:FBgn0027084 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_595892.1 Gene:krs1 PomBaseID:SPBC17G9.03c Length:591 Species:Schizosaccharomyces pombe

Alignment Length:574 Identity:357/575 (62%)
Similarity:435/575 (76%) Gaps:18/575 (3%)


  Fly    31 VSAPQMEP---SKQTKLELKRRLKAE----QKAKEKAEKAAAAPAENTAGKKKSSAAEEEEISPN 88
            |.|..::|   .:.:|.|||:|.|..    .|||::|||||:||    ....|||:.:||::.|:
pombe    13 VKALVLDPVTGEQVSKTELKKREKQRARELAKAKKQAEKAASAP----VAAPKSSSKKEEDLDPS 73

  Fly    89 EYFKLRSAAVQELKRSPATDPYPHKFHVSSSLEDFIAKYENSLKEGETLENVKLSVAGRVHAIRE 153
            :||:.||..:.||:::...:||||||.|:.:|.:|||||| .|..|||...|:::|||||..:|.
pombe    74 QYFENRSRTIMELRQTKDPNPYPHKFQVTITLPEFIAKYE-GLARGETKPEVEVAVAGRVLGLRT 137

  Fly   154 SGAKLIFYDLRGEGVKVQVMASAKSYKSEADFEIDTSKLRRGDIIGVVGHPGKTK-----KGELS 213
            :|.||.||::..:|.|:|||..|:. ....||......||||||||:.|:||::.     .||||
pombe   138 AGNKLRFYEIHADGKKLQVMCQAQD-ADTVDFAAQHEHLRRGDIIGIRGYPGRSNPKGRADGELS 201

  Fly   214 VMPSEIKLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNNNVREKFQIRAKIISYVRQFLDRLG 278
            :...:..||||||.|||..|:||||.|.|:||||||||:|.:.|::|.:|::||.|:|.|.|...
pombe   202 IFARQCVLLSPCLRMLPKEHYGLKDLEIRHRQRYLDLIMNRSTRDRFVMRSRIIQYIRHFFDSRD 266

  Fly   279 FLEIETPMMNMIAGGATAKPFVTHHNDLKMDLFMRIAPELYHKMLVVGGLDRVYEIGRQFRNEGI 343
            |:|:||||||||||||||||||||||||.|||:||||||||.||||||||||||||||||||||.
pombe   267 FMEVETPMMNMIAGGATAKPFVTHHNDLDMDLYMRIAPELYLKMLVVGGLDRVYEIGRQFRNEGA 331

  Fly   344 DLTHNPEFTTCEFYMAYADYADIMDITEQLVSGMVKAIRGSYKVIYHPEGPEGPEQELDFTPPFK 408
            |||||||||:.|||.|||||.|:||.||:|:||:||.:.|||||.|||||||||:.||||:.|::
pombe   332 DLTHNPEFTSIEFYQAYADYYDLMDTTEELLSGLVKDLTGSYKVPYHPEGPEGPKWELDFSRPWR 396

  Fly   409 RVSMIKTLEEKLQVKFPAADTFNSPETNQFLSQLCAKHQVECPAPRTTARLLDKLVGEFIEEFCV 473
            |::||:.|||||..|||..|..::||.|.||..|||||.|||..|:|.:||||||||||||..|:
pombe   397 RINMIEYLEEKLNTKFPPGDQLHTPEANAFLRDLCAKHGVECAPPQTCSRLLDKLVGEFIESECI 461

  Fly   474 NPTFICEHPQIMSPLAKYHRSIPGLTERFELFVAKKEICNAYTELNDPVVQRERFEQQASDKAAG 538
            |||||..|||:||||||||||..||.||||.|||.||||||||||||...||.|||:||..||.|
pombe   462 NPTFIIGHPQMMSPLAKYHRSDAGLCERFEAFVATKEICNAYTELNDIFDQRARFEEQARQKAQG 526

  Fly   539 DDEAQLVDENFCTSLEYGLPPTGGFGMGIDRLAMFLTDSNNIKEVLLFPAMKPE 592
            |||||::||||||:||||||||||:|||:|||.|||||||.|:||||||.||||
pombe   527 DDEAQIIDENFCTALEYGLPPTGGWGMGVDRLVMFLTDSNTIREVLLFPHMKPE 580

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LysRSNP_001188571.1 PLN02502 42..593 CDD:215278 354/561 (63%)
LysRS_N 141..250 CDD:239817 56/114 (49%)
LysRS_core 253..591 CDD:238398 247/338 (73%)
krs1NP_595892.1 PLN02502 23..580 CDD:215278 353/563 (63%)
LysRS_N 125..238 CDD:239817 56/114 (49%)
LysRS_core 241..579 CDD:238398 247/338 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H4053
Inparanoid 1 1.050 702 1.000 Inparanoid score I101
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004389
OrthoInspector 1 1.000 T1125923
orthoMCL 1 0.900 OOG5_126972
Panther 1 1.100 LDO PTHR42918
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1446
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.