DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LysRS and kars-1

Sequence 1:NP_001188571.1 Gene:LysRS FlyBaseID:FBgn0027084 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_495454.1 Gene:kars-1 WormBaseID:WBGene00002238 Length:596 Species:Caenorhabditis elegans

Alignment Length:566 Identity:342/567 (60%)
Similarity:429/567 (76%) Gaps:6/567 (1%)


  Fly    41 QTKLELKRRLKAEQKAKEKAEKAAAAPAENTAGKKKSSAAEEEEISPNEYFKLRSAAVQELKRSP 105
            |...|.||..|..:|.:|:.||.||......|...| ...|.:...|.|||.:|...: |.:|:.
 Worm    32 QNTREQKRLAKQAKKEQERLEKDAAKLNVAVADAPK-VVREADPSDPQEYFNMRVRMI-EARRAA 94

  Fly   106 ATDPYPHKFHVSSSLEDFIAKYENSLKEGETLENVKLSVAGRVHAIRESGAKLIFYDLRGEGVKV 170
            ..:|:||||:|:.||.|||.|| ..|::.:.:|.: :|||||:|:.||||:||:|||:.|||..:
 Worm    95 GDNPFPHKFNVTISLTDFITKY-TPLEKEQVVEEI-VSVAGRIHSKRESGSKLVFYDIHGEGTHI 157

  Fly   171 QVMASAKSYKSEADFEIDTSKLRRGDIIGVVGHPGKTKKGELSVMPSEIKLLSPCLHMLPHLHFG 235
            |:||:||.:..:.||.....:::||||:|..|...:||.||||::|:||..|:||||||||.|||
 Worm   158 QIMANAKFHTGDVDFVTLHDRIKRGDIVGFTGRATRTKAGELSLIPNEILQLTPCLHMLPHSHFG 222

  Fly   236 LKDKETRYRQRYLDLILNNNVREKFQIRAKIISYVRQFLDRLGFLEIETPMMNMIAGGATAKPFV 300
            |||||.|:|:||||||||..|::.|.||:|||:::|::||.|||||:|||:||.||||||||||:
 Worm   223 LKDKELRFRKRYLDLILNPRVKDNFVIRSKIITFLRRYLDNLGFLEVETPIMNQIAGGATAKPFI 287

  Fly   301 THHNDLKMDLFMRIAPELYHKMLVVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYAD 365
            ||||||.|:||:|:|||||||||||||:|||||:||.||||||||||||||||||||||||||.|
 Worm   288 THHNDLDMNLFLRVAPELYHKMLVVGGIDRVYEVGRLFRNEGIDLTHNPEFTTCEFYMAYADYED 352

  Fly   366 IMDITEQLVSGMVKAIRGSYKVIYHPEGPE-GPEQELDFTPPFKRVSMIKTLEEKLQVKFPAADT 429
            ::.:||.|:|.||.:|:|:||:.|||.||. .|..|:|||||||||.|...|.|||....|...|
 Worm   353 VIQLTEDLLSSMVMSIKGTYKIEYHPNGPNTEPVYEVDFTPPFKRVHMYDGLAEKLGATLPDPST 417

  Fly   430 FNSPETNQFLSQLCAKHQVECPAPRTTARLLDKLVGEFIEEFCVNPTFICEHPQIMSPLAKYHRS 494
            .::.|..:...:||..:.|:|.|||||||||||||||::|...::|||:..||||||||||:|||
 Worm   418 LHTEEAREVFDKLCRDNNVDCSAPRTTARLLDKLVGEYLESTFISPTFLIGHPQIMSPLAKWHRS 482

  Fly   495 IPGLTERFELFVAKKEICNAYTELNDPVVQRERFEQQASDKAAGDDEAQLVDENFCTSLEYGLPP 559
            |||||||||||...:||.|||||||||:.||:||||||.||.|||||||::||.||.:|||||||
 Worm   483 IPGLTERFELFAVTREIANAYTELNDPITQRQRFEQQAKDKDAGDDEAQMIDETFCNALEYGLPP 547

  Fly   560 TGGFGMGIDRLAMFLTDSNNIKEVLLFPAMKPEDANRTAAE-TAPT 604
            |||:|||||||:|.|||:||||||||||||:|||......: .|||
 Worm   548 TGGWGMGIDRLSMILTDNNNIKEVLLFPAMRPEDGTEKKTDFDAPT 593

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LysRSNP_001188571.1 PLN02502 42..593 CDD:215278 337/552 (61%)
LysRS_N 141..250 CDD:239817 63/109 (58%)
LysRS_core 253..591 CDD:238398 234/339 (69%)
kars-1NP_495454.1 MAS20 17..>97 CDD:295844 21/67 (31%)
PLN02502 35..581 CDD:215278 337/550 (61%)
LysRS_N 128..237 CDD:239817 63/110 (57%)
LysRS_core 240..579 CDD:238398 234/339 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C77792772
eggNOG 1 0.900 E1_COG1190
Hieranoid 1 1.000
Homologene 1 1.000 H4053
Inparanoid 1 1.050 695 1.000 Inparanoid score I348
Isobase 1 0.950 0 Normalized mean entropy S299
OMA 1 1.010
OrthoDB 1 1.010 D258797at33208
OrthoFinder 1 1.000 FOG0004389
OrthoInspector 1 1.000 T477136
orthoMCL 1 0.900 OOG5_126972
Panther 1 1.100 LDO PTHR42918
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1446
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.