DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rrp40 and RRP40

Sequence 1:NP_001285565.1 Gene:Rrp40 FlyBaseID:FBgn0260648 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_014499.2 Gene:RRP40 SGDID:S000005502 Length:240 Species:Saccharomyces cerevisiae

Alignment Length:214 Identity:75/215 (35%)
Similarity:112/215 (52%) Gaps:14/215 (7%)


  Fly     5 STIVMPGERIAAIEELAKSKRVILGPGLRRLDDT--VVASKAGPLRHKEPG-----TFWVDNYQR 62
            ||.:.||:..    .:..:..|.||||:....:|  :.....|.|.....|     |.::|...:
Yeast     2 STFIFPGDSF----PVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKSGVQTAYIDYSSK 62

  Fly    63 RYIPARGDLILGIVRAKAGDLYRVDI-GATDTASISYLAFEAASKKNRPDLIPGDLIYARVLNAS 126
            ||||:..|.::|::.....|.|:|.: ..:.:.|:||:||..|||||||.|..|||:||||..|.
Yeast    63 RYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAE 127

  Fly   127 ADIEPELVCVNS-VGKSGKLGVLTDGFFFKCSLNLGRMLLREN-CPVLAALTRELPYEIAVGVNG 189
            .::|.|:.|.:| .|:....|:|.||.....:||..|.||..| .|:|..|.....:|:|:|:||
Yeast   128 KELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNG 192

  Fly   190 RIWLKAHSLKETVALANAI 208
            :||:|...|..|:|....|
Yeast   193 KIWVKCEELSNTLACYRTI 211

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rrp40NP_001285565.1 ECR1_N 7..48 CDD:291080 10/43 (23%)
S1_Rrp40 63..148 CDD:240216 36/87 (41%)
KH_6 151..197 CDD:292607 18/47 (38%)
RRP40NP_014499.2 Rrp4 1..240 CDD:224022 75/215 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C336130090
eggNOG 1 0.900 E1_COG1097
Hieranoid 1 1.000
Homologene 1 1.000 H6867
Inparanoid 1 1.050 122 1.000 Inparanoid score I1280
Isobase 1 0.950 0.878984 Normalized mean entropy S1604
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002960
OrthoInspector 1 1.000 T1135992
orthoMCL 1 0.900 OOG5_128098
Panther 1 1.100 LDO PTHR21321
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2268
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.