DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rrp40 and Exosc3

Sequence 1:NP_001285565.1 Gene:Rrp40 FlyBaseID:FBgn0260648 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_079789.1 Gene:Exosc3 MGIID:1913612 Length:274 Species:Mus musculus

Alignment Length:247 Identity:103/248 (42%)
Similarity:159/248 (64%) Gaps:25/248 (10%)


  Fly     7 IVMPGERI-------------AAIEEL-----AKSK-RVILGPGLRRLDDTVVASKAGPLRHKEP 52
            :|:|||.:             |..:.|     |:.: ||:.||||||..|.::.:|.|.||||||
Mouse    27 VVLPGEELVLPDHEDVDGLGGAGEQPLRLNAGARPRLRVVCGPGLRRCGDRLLVTKCGRLRHKEP 91

  Fly    53 -----GTFWVDNYQRRYIPARGDLILGIVRAKAGDLYRVDIGATDTASISYLAFEAASKKNRPDL 112
                 |.:|||:.|:||:|.:||.::|||.||:||:::||:|.::.||:||||||.|:|:|||::
Mouse    92 SGGGGGVYWVDSQQKRYVPVKGDHVIGIVIAKSGDIFKVDVGGSEPASLSYLAFEGATKRNRPNV 156

  Fly   113 IPGDLIYARVLNASADIEPELVCVNSVGKSGKLGVL-TDGFFFKCSLNLGRMLLRENCPVLAALT 176
            ..|||||.:.:.|:.|:|||:||::|.|::..:||: .||..||.:|.|.|.||..:|.::..|.
Mouse   157 QVGDLIYGQCVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIVQELG 221

  Fly   177 RELPYEIAVGVNGRIWLKAHSLKETVALANAISALEQSGCAEIDKICGNLGD 228
            :..|.||..|:|||||:||.::::|:.|||.:.|.|.....:..:|...|.:
Mouse   222 KLYPLEIVFGMNGRIWVKAKTIQQTLILANVLEACEHMTTEQRKQIFARLAE 273

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rrp40NP_001285565.1 ECR1_N 7..48 CDD:291080 19/60 (32%)
S1_Rrp40 63..148 CDD:240216 44/85 (52%)
KH_6 151..197 CDD:292607 21/46 (46%)
Exosc3NP_079789.1 S1_Rrp40 107..192 CDD:240216 44/85 (52%)
KH_6 196..242 CDD:292607 21/46 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C336123238
eggNOG 1 0.900 E1_COG1097
Hieranoid 1 1.000
Homologene 1 1.000 H6867
Inparanoid 1 1.050 201 1.000 Inparanoid score I3744
Isobase 1 0.950 0.878984 Normalized mean entropy S1604
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002960
OrthoInspector 1 1.000 T1083327
orthoMCL 1 0.900 OOG5_128098
Panther 1 1.100 LDO PTHR21321
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2268
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.