DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rrp40 and Exosc3

Sequence 1:NP_001285565.1 Gene:Rrp40 FlyBaseID:FBgn0260648 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_006238129.1 Gene:Exosc3 RGDID:1304739 Length:287 Species:Rattus norvegicus

Alignment Length:235 Identity:99/236 (42%)
Similarity:154/236 (65%) Gaps:16/236 (7%)


  Fly    10 PGERIAAIEELAKSK-RVILGPGLRRLDDTVVASKAGPLRHKEP--------------GTFWVDN 59
            |||:...:...|:.: |::.||||||..|.::.:|.|.||||||              |.:|||:
  Rat    52 PGEQPLRLNAGARPRLRIVCGPGLRRCGDRLLVTKCGRLRHKEPSGGGGGGGGGGGGGGVYWVDS 116

  Fly    60 YQRRYIPARGDLILGIVRAKAGDLYRVDIGATDTASISYLAFEAASKKNRPDLIPGDLIYARVLN 124
            .|:||:|.:||.::|||.||:||:::||:|.::.||:||||||.|:|:|||::..|||||.:.:.
  Rat   117 QQKRYVPVKGDHVIGIVVAKSGDIFKVDVGGSEPASLSYLAFEGATKRNRPNVQVGDLIYGQCVV 181

  Fly   125 ASADIEPELVCVNSVGKSGKLGVL-TDGFFFKCSLNLGRMLLRENCPVLAALTRELPYEIAVGVN 188
            |:.|:|||:||::|.|::..:||: .||..||.:|.|.|.||..:|.::..|.:..|.||..|:|
  Rat   182 ANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIVQELGKLYPLEIVFGMN 246

  Fly   189 GRIWLKAHSLKETVALANAISALEQSGCAEIDKICGNLGD 228
            ||||:||.::::|:.|||.:.|.|.....:..:|...|.:
  Rat   247 GRIWVKAKTIQQTLILANVLEACEHMTTEQRKQIFARLAE 286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rrp40NP_001285565.1 ECR1_N 7..48 CDD:291080 15/39 (38%)
S1_Rrp40 63..148 CDD:240216 44/85 (52%)
KH_6 151..197 CDD:292607 21/46 (46%)
Exosc3XP_006238129.1 S1_Rrp40 120..205 CDD:240216 44/85 (52%)
KH_6 209..255 CDD:292607 21/46 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C336126241
eggNOG 1 0.900 E1_COG1097
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H6867
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1284731at2759
OrthoFinder 1 1.000 FOG0002960
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128098
Panther 1 1.100 LDO PTHR21321
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
87.800

Return to query results.
Submit another query.