DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rrp40 and exos-3

Sequence 1:NP_001285565.1 Gene:Rrp40 FlyBaseID:FBgn0260648 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_492751.1 Gene:exos-3 WormBaseID:WBGene00010325 Length:226 Species:Caenorhabditis elegans

Alignment Length:207 Identity:76/208 (37%)
Similarity:122/208 (59%) Gaps:4/208 (2%)


  Fly     6 TIVMPGERIAAIEELAKSKRVILGPGLRRLDDTVVASKAGPLRHKEPGTFWVDNYQRRYIPARGD 70
            |:.:||:   .|.|.:.|...|:|.|:.....|.:|::.|.. |.:.|..|::.:.:||||..||
 Worm     2 TVYLPGD---VINEPSSSDSSIIGYGISVRGQTRIATQPGAF-HNDDGKVWLNVHSKRYIPQEGD 62

  Fly    71 LILGIVRAKAGDLYRVDIGATDTASISYLAFEAASKKNRPDLIPGDLIYARVLNASADIEPELVC 135
            .::.||.:|.||.:|:|||..:.|.|::..||.|:|:|||:|..||:|||.|.:.:...|.||.|
 Worm    63 RVIAIVTSKTGDFFRLDIGTAEYAMINFTNFEGATKRNRPNLKTGDIIYATVFDTTPRTEAELTC 127

  Fly   136 VNSVGKSGKLGVLTDGFFFKCSLNLGRMLLRENCPVLAALTRELPYEIAVGVNGRIWLKAHSLKE 200
            |:...::..:|.|..||.||.|||..|.|:..:|.:|..:.:...:||.||:|||||:.|.:..:
 Worm   128 VDDEKRARGMGQLNGGFMFKVSLNHCRRLINPSCKILQTVGKFFKFEITVGMNGRIWISASTSDD 192

  Fly   201 TVALANAISALE 212
            .:.:.:.|:..|
 Worm   193 IIKIHDIINKSE 204

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rrp40NP_001285565.1 ECR1_N 7..48 CDD:291080 11/41 (27%)
S1_Rrp40 63..148 CDD:240216 37/85 (44%)
KH_6 151..197 CDD:292607 21/46 (46%)
exos-3NP_492751.1 S1_Rrp40 55..140 CDD:240216 37/85 (44%)
KH_6 143..189 CDD:292607 21/46 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C336117738
eggNOG 1 0.900 E1_COG1097
Hieranoid 1 1.000
Homologene 1 1.000 H6867
Inparanoid 1 1.050 149 1.000 Inparanoid score I2947
Isobase 1 0.950 0.878984 Normalized mean entropy S1604
OMA 1 1.010
OrthoDB 1 1.010 D1284731at2759
OrthoFinder 1 1.000 FOG0002960
OrthoInspector 1 1.000 T477659
orthoMCL 1 0.900 OOG5_128098
Panther 1 1.100 LDO PTHR21321
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2268
TreeFam 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.