DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rrp40 and exosc3

Sequence 1:NP_001285565.1 Gene:Rrp40 FlyBaseID:FBgn0260648 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_002936379.2 Gene:exosc3 XenbaseID:XB-GENE-966926 Length:250 Species:Xenopus tropicalis

Alignment Length:231 Identity:96/232 (41%)
Similarity:148/232 (64%) Gaps:19/232 (8%)


  Fly     1 MSATS------TIVMPGE--------RIAAIE----ELAKSKRVILGPGLRRLDDTVVASKAGPL 47
            |||.|      .||:||:        |.|.:.    ..:...||:.||||.|.:|.::.:|.|.|
 Frog     1 MSAVSIEDAVGQIVLPGDVLVLSTQSRDAPLSLSGPSTSNRPRVVCGPGLMRQEDDLLVNKCGLL 65

  Fly    48 RHKEPGTFWVDNYQRRYIPARGDLILGIVRAKAGDLYRVDIGATDTASISYLAFEAASKKNRPDL 112
            ||::|..:|||:.|:||:|.:||.::|||..|:||:::||:|.::.||:||||||.|:|||||::
 Frog    66 RHRDPAIYWVDSQQKRYVPVKGDHVIGIVTTKSGDIFKVDVGGSEQASLSYLAFEGATKKNRPNV 130

  Fly   113 IPGDLIYARVLNASADIEPELVCVNSVGKSGKLGVL-TDGFFFKCSLNLGRMLLRENCPVLAALT 176
            ..|||:|.:.:.|:.|:|||:.|::|.||:...||: .||...|.||.|.|.||.....::..|.
 Frog   131 KVGDLVYGQFIVANKDMEPEMACIDSSGKANGKGVIGQDGLMLKVSLGLVRKLLIPQNDIVQELM 195

  Fly   177 RELPYEIAVGVNGRIWLKAHSLKETVALANAISALE 212
            ...|.|:.:|:|||||:||.::::|:.:||.:.|.|
 Frog   196 NIFPMEVVIGMNGRIWVKAKTVQQTLIVANLLEACE 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rrp40NP_001285565.1 ECR1_N 7..48 CDD:291080 17/53 (32%)
S1_Rrp40 63..148 CDD:240216 43/85 (51%)
KH_6 151..197 CDD:292607 19/46 (41%)
exosc3XP_002936379.2 S1_Rrp40 81..166 CDD:240216 43/85 (51%)
KH_6 170..216 CDD:292607 19/46 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C336126461
eggNOG 1 0.900 E1_COG1097
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H6867
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1284731at2759
OrthoFinder 1 1.000 FOG0002960
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.