DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31921 and VGF

Sequence 1:NP_722627.1 Gene:CG31921 FlyBaseID:FBgn0051921 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_003369.2 Gene:VGF HGNCID:12684 Length:615 Species:Homo sapiens

Alignment Length:549 Identity:108/550 (20%)
Similarity:196/550 (36%) Gaps:100/550 (18%)


  Fly    71 RNYLSESVDQGGC---LDPSTKGQDAVRIWKLSPHKSTLKFYGVADGLKLPEAVKFDRTLTTSLK 132
            ||  ||..|:|..   :||  :...||.:..|....|.....|...|   ||....:..||.:::
Human    63 RN--SEPQDEGELFQGVDP--RALAAVLLQALDRPASPPAPSGSQQG---PEEEAAEALLTETVR 120

  Fly   133 HANGSRRPVPKPPVPLEPKRPPQPVS---LCQPYILNRQTLKEELQRMPIALQKL---NPKEAFN 191
            ....| .|.|:.|.|..|.||..|.:   ...|        .|||:.:...||:|   :|..|  
Human   121 SQTHS-LPAPESPEPAAPPRPQTPENGPEASDP--------SEELEALASLLQELRDFSPSSA-- 174

  Fly   192 TLFCEKREDPMDPLGVEAATNQIVSLREALDMAKPETPSKHGLRRKHW-----YCPSKCGEPENK 251
                 ||:.       |.|..:..:....|.....|:|....:.|..|     ..|.:...|...
Human   175 -----KRQQ-------ETAAAETETRTHTLTRVNLESPGPERVWRASWGEFQARVPERAPLPPPA 227

  Fly   252 CTVFEWAQYKLNPPPYDKAFFKWFQEQKVQLEREPHDYDELYKRFQACFEEKGQPDPECVAMAKC 316
            .:.|:.......|.|....|.:.....|..|........:.|:...|.|.:..:|:...:.    
Human   228 PSQFQARMPDSGPLPETHKFGEGVSSPKTHLGEALAPLSKAYQGVAAPFPKARRPESALLG---- 288

  Fly   317 CPDMIKETKDEYGVGEGGTGGGGGTHNTKEGDGQTGSGVSGPEGVSQSGKDKEKGRVKKSDDL-- 379
                               |...|....::|..|..:|....|...|:...:|:.....||.|  
Human   289 -------------------GSEAGERLLQQGLAQVEAGRRQAEATRQAAAQEERLADLASDLLLQ 334

  Fly   380 -----GDTEKDKETDKSKSTGKDNEKNKEDKEKEKDK--GKDKVKDNEKEKDKGKDKVKDKDKDA 437
                 |..::.......:...::.|..:|::|.|:::  |:::|.:.::|..:.:.:.::.:: |
Human   335 YLLQGGARQRGLGGRGLQEAAEERESAREEEEAEQERRGGEERVGEEDEEAAEAEAEAEEAER-A 398

  Fly   438 DTDKGKSTDEDKGKHNAKDKDKSKEKDKNNDTNQNNKKKNIADPDHEQLKPKHPGKQPKPPIENT 502
            ..:.....:|:.|:..|:||...:|...:........::...:.|.|::.|:        .|::.
Human   399 RQNALLFAEEEDGEAGAEDKRSQEETPGHRRKEAEGTEEGGEEEDDEEMDPQ--------TIDSL 455

  Fly   503 TDTSTHNISSFISRDSDKISIQEDIIKEKGDPSAKDGVEDKPTQPSSTKP---HNKKPASKKPPK 564
            .:.||   ...:..| |.:||.|::.:::   ..|.....:|..|....|   |.:.|....|..
Human   456 IELST---KLHLPAD-DVVSIIEEVEEKR---KRKKNAPPEPVPPPRAAPAPTHVRSPQPPPPAP 513

  Fly   565 GKTGEEKPQKVD-----EKEVKESCPPCP 588
            ....:|.|...:     ::|..|..||.|
Human   514 APARDELPDWNEVLPPWDREEDEVYPPGP 542



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.