DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31921 and CG31797

Sequence 1:NP_722627.1 Gene:CG31921 FlyBaseID:FBgn0051921 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_724173.1 Gene:CG31797 FlyBaseID:FBgn0051797 Length:868 Species:Drosophila melanogaster

Alignment Length:849 Identity:239/850 (28%)
Similarity:365/850 (43%) Gaps:207/850 (24%)


  Fly    53 ERYPSIRPPVSKC--SNDQTRNYLSESVDQGGCLDPSTKGQDAVRI-WKLSPHKSTLKFYGVADG 114
            |.|||||.....|  :.::....|:.:::..|...|....:|.|.: |:.||||.||.||||...
  Fly    35 ETYPSIRKGKPHCDPNKNEATTRLANTLEADGSGRPYDMVKDDVLLAWQQSPHKDTLGFYGVGSP 99

  Fly   115 LKLPEAVKFDRTLTTSLKHAN--GSRRPVP---KPPVP----LEPKRPPQPVSLCQPYILNRQTL 170
            ...||:|.|::.:...|...|  |::|.:|   |.|.|    .:..|.||   :|:|::|||..|
  Fly   100 THQPESVVFNQVVAACLVKVNGGGTQRRIPKQDKKPSPRDTLAQKNRTPQ---ICKPFVLNRHAL 161

  Fly   171 KEELQRMPIALQKLNPKEAFNTLFC-EKREDPMDPLGVEAATNQIVSLREALDMAKPETPSKHGL 234
            :.:||::|...|:|:|::||.||:| :..:.|.|...|.......:|..:..::.........||
  Fly   162 QSDLQQIPHVQQQLDPRQAFGTLYCTDHNQVPHDSTRVARQMYTGISRHQVSNIEPARKKDPRGL 226

  Fly   235 RRKHWYCPSKCGEPENKCTVFEWAQYKLNPPPYDKAFFKWFQEQKVQLEREPHDYDELYKRFQAC 299
            |...||||....||.:.||.:|||:.||:|.|.:..|....|.:......||.:||:||.|...|
  Fly   227 RHPQWYCPPDGLEPRHGCTQYEWAKRKLDPNPNNNEFRHCPQGKDEHKSPEPLNYDQLYSRIIKC 291

  Fly   300 FEEKGQPDPECVAMAKCCPDMIKETKDEYGVGE-------------GGTGGGGGTHNTKE----- 346
            ||.|..|||.|....|||.......||..|.|:             .|..|....|..:|     
  Fly   292 FEPKPSPDPLCEPYEKCCKPKRSHGKDNQGGGDSQIPKGPSRPTKSSGDPGNPIGHGNREPGEED 356

  Fly   347 --------GDGQTGSGVSGPEGVSQSGKDKEKGRVKKSDDLGDTEKDKETDK--------SKSTG 395
                    |:|..|...:..:......|||.:..:|::|:.||...||..||        :|...
  Fly   357 KVTIVRDDGNGDRGDKENDKDKNQFVNKDKPRVSIKENDNDGDQNNDKNKDKVVNFNQEENKYKN 421

  Fly   396 KDNEKNKEDKEKE-----KDKGKDKVKDNEKEKDKGKDKV-KDKDKDADTDKGKSTDEDKGKHNA 454
            :|..|||||||||     ::|.|:|.|..:||.:|.::|| |.|:|:.:|.|||....::.|.|.
  Fly   422 QDRYKNKEDKEKEREKKKREKAKEKKKGKDKETEKKREKVKKKKEKNKETGKGKEKARERDKENY 486

  Fly   455 KD------------KDKSKEKDKNNDTNQNNKKKNIA-----------DPDHEQLKP-------K 489
            |.            |::.||:::|...|:|||:|.:.           :..||:.||       :
  Fly   487 KGIERPREKEEGERKEREKEEEENEIENENNKEKELGKEQEIEKFKERERPHEKDKPMEREQERE 551

  Fly   490 HPGKQPKPPIENTTDTSTHNISSFISRDSDK-------ISIQEDIIKEKGDPS-AKDGVEDKPTQ 546
            ..|||.:...|..           |.::.:|       ::.:.:..|:|.|.: .||...:|..:
  Fly   552 EKGKQEEKERERG-----------IEKEREKGKGKEKEVNKEHETGKQKEDKNRGKDQFPEKGKE 605

  Fly   547 PSSTK----------------------------PHNKKPASKKPPKGKTGEEKP----------- 572
            ....|                            |:|||..:|.....|..|.||           
  Fly   606 KKQQKHKEKYKDEDKIKDMDLEYEKYDRDDIKIPNNKKNKNKSNEDSKIEENKPNSNLPEVTSRF 670

  Fly   573 -----------------------------------------------------QKVDEKEVKESC 584
                                                                 :||.:.:.|:.|
  Fly   671 FDIPVDMEFDKTIKRGTRVEDYEFPALEIVRDEPAAPTCKLKDPPKKKKMKRIKKVCKDKPKKVC 735

  Fly   585 PPCPPVGCACTICDCLYGTKIPI----SPKMQSIMAEEKLREKREYLRRMRHRAYM--DCTSEKP 643
            |||||.||.|.||..:   ..|.    :|.|:.:...|:.|:.|.|.|:|||:.|:  .|.:|. 
  Fly   736 PPCPPAGCQCEICHFM---DRPFNEQEAPFMREMRRVEQKRQLRAYYRQMRHQEYIRDRCKTEY- 796

  Fly   644 LVPQHKVDPISCDNCFCLDPKISEYCECLRALQHLQRLLGKERHRIVNNELIFNLDDLRQRIANR 708
            ..|:|:.|||.|.|..|.:|:::|:|:||.|:|.||.||...:....::.|:..:::||:|:..|
  Fly   797 RAPRHQCDPIYCSNFLCQNPRLAEHCDCLGAVQELQNLLSGSKDNEDHSRLLLRVENLRKRVCQR 861

  Fly   709 MCKC 712
            ||.|
  Fly   862 MCDC 865



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133931374
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.