DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31921 and CG43755

Sequence 1:NP_722627.1 Gene:CG31921 FlyBaseID:FBgn0051921 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001259819.1 Gene:CG43755 FlyBaseID:FBgn0264086 Length:682 Species:Drosophila melanogaster

Alignment Length:709 Identity:252/710 (35%)
Similarity:358/710 (50%) Gaps:108/710 (15%)


  Fly    34 TPYELMRQRNCKAEKIIKWERYPSIRPPVSKCSNDQTRNYLSESVDQGGCLDPSTKGQDAVRIWK 98
            |.|:.||.||||..|....|.||||.||:|||.:.:|..|:..:::...|.:  ...:|.:.:|.
  Fly    41 TLYQWMRWRNCKTHKPHLEETYPSILPPISKCDDAKTLKYVENAMEANKCKE--YVKEDVLTVWN 103

  Fly    99 LSPHKSTLKFYGVADGLKLPEAVKFDRTLTTSLKHANGSRRPVPKPPVP--LEP-----KRPPQP 156
            .||.|.:|.:|||......|:||.:||.|..|||.|:    ..||||..  ::|     |:||||
  Fly   104 YSPQKESLVWYGVKSQYPSPQAVLYDRALKKSLKAAS----LAPKPPKKSNIKPKWQLQKKPPQP 164

  Fly   157 VSLCQPYILNRQTLKEELQRMPIALQKLNPKEAFNTLFCEKREDPMDPLGVEAATNQIVSLREAL 221
            .:    ::|||:.||.:|:|||...::|.....|:.|.|.:..||.:|.. ::|....:|:.:|:
  Fly   165 GA----FVLNRKCLKAKLERMPNIKRQLKSNNVFSWLHCPQPADPSNPFD-DSAVYPAISIEQAM 224

  Fly   222 DMAKPETPSKHGLRRKHWYCPSKCGEPENKCTVFEWAQYKLNPPPYDKAFFKWFQEQKVQLEREP 286
            ||||||.|.||||||||||||.||||.|:|||.:|||:||::|.|.::||.:....||...:.||
  Fly   225 DMAKPEKPPKHGLRRKHWYCPPKCGEAESKCTDYEWAKYKMDPRPDNEAFQREMANQKAFKQPEP 289

  Fly   287 HDYDELYKRFQACFEEKGQPDPE-----CVAMAKCCPDMIKETKD--EYGVGEGGTGGGGGTHNT 344
            .:||||||....||.:    ||.     |.|:.|||    ::.||  ..|..|....|.|     
  Fly   290 RNYDELYKSLVTCFVQ----DPNGKNDLCEALEKCC----RDPKDPPAQGCSEFVPDGAG----- 341

  Fly   345 KEGDGQTGSGVSGPEGVSQSGKDKEKGRVKKSD-----DLG---DTEKDKETDKSKSTGKDNEK- 400
              |||             :|..||:|||.|..|     |:.   |.:|||..||.|:...|||. 
  Fly   342 --GDG-------------ESAVDKDKGRDKDVDIDIHVDIDKDVDIDKDKRKDKGKTGDGDNENE 391

  Fly   401 --NKEDKEK--EKDKGKDKVKDNEKEKDKGKDKVKDKDKDADTDKGKSTDEDKGKHNAKDKDKSK 461
              ...|.||  :.||||.:..|.  |.:||.:|...:.|.|..::.|..|::||....|:|.|.|
  Fly   392 GIGDGDGEKGGQNDKGKHEKGDG--EGNKGSEKDGGEKKPAKQNEVKENDKEKGMEKGKEKGKEK 454

  Fly   462 EKDKNNDTNQNNKKKNIADPDHEQLKPKHPGKQPKPPIENTTDTSTHNISSFISRDSDKISIQED 526
            .|:|        |.|          :|.....:.:||:..:.|| ||........|.|......|
  Fly   455 GKEK--------KTK----------EPNFRSSEDRPPVPQSKDT-THGTEESHHGDGDFGGPDGD 500

  Fly   527 IIKEKGDPSAKDGV------EDKPTQPSSTKPHNKKPASKKPPKGKTGEEKPQKVDEKEVKESCP 585
            ..|.|..|..|.|:      :||.......|..|||...||.||.| .|:|..| |.:..|:   
  Fly   501 REKGKNQPDGKSGIVDQNQGKDKDKGKGKEKGMNKKGKGKKKPKDK-DEDKNTK-DNRSEKD--- 560

  Fly   586 PCPPVGCACTICDCLYGTKIPISPKMQSIMAEEKLREKREYLRRMRHRAYMDCTSEKPLVPQHKV 650
                  |.|.|| |  ..|...:|.::.:...::.|:.|:|||:||||.||:|...|...|.||.
  Fly   561 ------CPCEIC-C--PPKEEDTPLIKEMRRRDRERQVRDYLRQMRHRQYMECKDLKYPSPHHKC 616

  Fly   651 DPISCDNCFCLDPKISEYCECLRALQHLQRLLGKERHRIVNNELIFNLDDLRQRIANRM 709
            |||.|:|.||.:|::..:...::|::.||::| :.|:|..:.::..:||.|..|:.|.:
  Fly   617 DPIQCNNQFCSNPRMQTHFARVQAVRSLQQIL-QRRNRQGDVKISKDLDSLLARLCNSL 674

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31921NP_722627.1 None
CG43755NP_001259819.1 III <382..>425 CDD:164795 16/45 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133931326
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.