DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur29B and spty2d1

DIOPT Version :8

Sequence 1:NP_723377.1 Gene:Mur29B / 319014 FlyBaseID:FBgn0051901 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001072434.1 Gene:spty2d1 / 779888 XenbaseID:XB-GENE-5939956 Length:778 Species:Xenopus tropicalis

Alignment Length:441 Identity:116/442 (26%)
Similarity:183/442 (41%) Gaps:59/442 (13%)


  Fly    94 TASASTTDSSTASSTTIGESSSSSLGSSTSDSSTSDSTTDSSTASST-TIGDSSSSSLGSSTSDS 157
            |.|.::..|||..:.||.:|||.: ||.|..|.:...|.:|...||. .:|...|..  :.|.|.
 Frog   245 THSGNSKSSSTEQNGTIRKSSSDT-GSRTEKSGSVFHTKESKKPSSAKDLGGKGSRP--NVTGDG 306

  Fly   158 STSDSTTDSSTASSTTIGDSSTSSLGSST---------SDSSTSDSTTDSSTASSTTIGDSSTSS 213
            ....|::..|.||::..|..|.|:..|.:         |.||:..||..|::.|:.::|.|.:.|
 Frog   307 KDRHSSSQPSAASNSAFGRPSGSARPSGSSGPGRPLGGSGSSSGKSTGGSASGSARSVGGSGSGS 371

  Fly   214 ------------LGSSTSDSSTSDSTTDSSTASSTTIGDSSTSSLGSSTSDSSNSDSTTDSSTVS 266
                        :|...|...:...|..:.:.|....|.|.:.| |..|..|.::.|..:|.:.|
 Frog   372 GKPMGGSGSGKPIGGLHSSHGSGKPTGGTGSGSGKPTGASGSGS-GKPTGSSGSAKSVRESGSGS 435

  Fly   267 -STTIGDSSSSSLGSSTSDSSTSDSTTDSSTASSTTIGDSSSSSLGSSTSDSSTSDSTTDSSTA- 329
             |.....|.|.|:..|.|.|.::.|..:|.:      |..|:.|:..|.|.|.::.|..:|.:| 
 Frog   436 RSVRESGSGSRSVRESGSGSGSARSVRESGS------GSGSARSVRESGSGSGSARSVRESGSAK 494

  Fly   330 ------SSTTIGDSSTSSLGSSTSDSSTSDSTTDSSTASSTTIGDSSSSSLGSSTSDSSTYDSTT 388
                  |...:|..|:.:..||.|..:.......|.:|..::.|...|||:|.|||:||...|  
 Frog   495 QAGGPGSGRALGSGSSFARPSSNSSPAPGKPAAGSGSARPSSSGTPRSSSMGHSTSNSSRQPS-- 557

  Fly   389 DSSTASSTTIGDSSSSSLGSSTSDSSTSDSTTDSST-ASSTTIGDSSSSSLGSSTTDSSTVSSTT 452
                 ||..:..||....|::....|.......:|. .:||::..|:.|||||........|:|.
 Frog   558 -----SSGAVRPSSGPPTGATPKGPSPRPGAGPTSVRPNSTSVPGSARSSLGSGPGRPVAASATG 617

  Fly   453 N-AGSTASSTTSSPSISTSTSSPTNYKIAACYSIYKDGELNRGCVKVPEKH 502
            . |.:....|..:.:||:....|.:.          :|.:|......|..|
 Frog   618 QLAPAKPKCTVVAETISSKNFVPKSI----------NGHMNGIRTAAPPGH 658

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mur29BNP_723377.1 None
spty2d1NP_001072434.1 Important for interaction with DNA. {ECO:0000250|UniProtKB:Q68D10} 1..665 116/442 (26%)
Important for interaction with histones. {ECO:0000250|UniProtKB:Q68D10} 666..778
SPT2 693..>750 CDD:285455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.