DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur29B and SPBC215.13

DIOPT Version :8

Sequence 1:NP_723377.1 Gene:Mur29B / 319014 FlyBaseID:FBgn0051901 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_596690.1 Gene:SPBC215.13 / 2540669 PomBaseID:SPBC215.13 Length:534 Species:Schizosaccharomyces pombe

Alignment Length:578 Identity:208/579 (36%)
Similarity:304/579 (53%) Gaps:82/579 (14%)


  Fly     6 VNLLLMAICA-CSTLWPANALQCYSCVGNECHVETVPTVTCTLDDVSAAFGLDTNAAFNPFKRSL 69
            :.||...||. |.:.....|...:...||.         :.|...::...|.|:.....  :|..
pombe     3 LRLLFSLICVFCISNIFTQAFLVHQIYGNS---------SFTKISLNQLEGRDSQEELQ--RRQE 56

  Fly    70 LSVMPRAADDDST-------TGSTTIEDS--STTASASTTDSSTASSTTIGESSSSSLGSSTS-D 124
            :....|||:...|       |.:::.|.|  |.:|:.|.|:|.::..::..:.::|.|.|||| .
pombe    57 IRYYGRAAETGGTPTYYGYATPTSSSEPSIFSESATPSETNSYSSPVSSYSDPATSQLPSSTSFF 121

  Fly   125 SSTSDSTTDSSTASSTTIGDSSSSS--LGSSTSDSSTSDSTTDSSTASSTTIGDSSTSSLGSSTS 187
            |.||...|.|||.||:.:..||.||  |.|||   |...|.:.||.:||..:..|:.|||.||||
pombe   122 SPTSSEYTPSSTESSSLLDPSSVSSAILPSST---SVEVSISSSSLSSSDPLTSSTFSSLSSSTS 183

  Fly   188 DSSTSDSTTDSSTASSTTIGDSSTSSLGSST-SDSSTSDSTTDSSTASSTTIGDSSTSSLGSSTS 251
            .|..|.|:|.|||.||.....:|:|.|.||: ..||:|.|::.|||.:|:::   ||||:.|::|
pombe   184 SSQPSVSSTSSSTFSSAAPTSTSSSYLSSSSVVSSSSSPSSSSSSTLTSSSL---STSSIPSTSS 245

  Fly   252 DSSNSDSTTDSSTVSSTTIGDSSSSSLGSSTSDSSTSDSTTDSSTASSTTIGDSSSSSLGSSTSD 316
            .||::.|:..||:.|||....|||||:.||:|.||:|.::| |||.|      |||||..|.||.
pombe   246 SSSSTSSSLSSSSSSSTASSSSSSSSIISSSSSSSSSPTST-SSTIS------SSSSSSSSPTST 303

  Fly   317 SSTSDSTTDSSTASSTTIGDSSTSSLGSSTSDSSTSDSTTDSSTASSTTIGDSSSSSLGSSTSDS 381
            |||..|::.||::.|:|:..||.|| .||.|.|.||.|:|.||::||.:  .||.||..||:..|
pombe   304 SSTISSSSSSSSSFSSTLSSSSMSS-SSSFSSSPTSSSSTISSSSSSPS--SSSFSSTTSSSKSS 365

  Fly   382 STYDST--TDSSTASSTTIGDSSSSSLGSSTSDSSTSDSTTDSSTASSTTIGDSSSSSLGSSTTD 444
            |::.||  :.|||:|||....|||||..:|:|..|:|.|:..||::|.::....||:...:||:.
pombe   366 SSFSSTVSSSSSTSSSTLTSSSSSSSRPASSSSHSSSLSSHKSSSSSKSSSAPVSSAFYHNSTSS 430

  Fly   445 SSTVSSTTNAGSTASS----TTSSPSISTSTSSPTNYKIAACYSIYKDGELNRGCVKVPEKHSGC 505
            .|:..|::::.|:.||    |.||.|:.||:|.  .|:.:..|           .|.|....||.
pombe   431 RSSSHSSSHSLSSLSSKPILTASSSSLLTSSSH--TYERSTVY-----------VVTVETVSSGS 482

  Fly   506 QAVRNE-------LGITEDSADQCDICLTNLCNGST---------SLKVSLGAMILLL 547
            ....::       |.|..||:.      |:....|:         ||.|.|.|.|:::
pombe   483 STYASQSTQTSILLVIVGDSSS------TDSSGASSTHSKTSIFFSLFVVLAAAIVII 534



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.