DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fum4 and FUM2

Sequence 1:NP_723527.1 Gene:Fum4 FlyBaseID:FBgn0051874 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_851166.1 Gene:FUM2 AraportID:AT5G50950 Length:510 Species:Arabidopsis thaliana

Alignment Length:435 Identity:244/436 (56%)
Similarity:312/436 (72%) Gaps:3/436 (1%)


  Fly    24 RVEYDSMGAVHIPLDRMFGPQTMRSLMKFPIGGVEERMPRPLIKALGIVKKSAAETNKIHCLEEH 88
            |.|.|:.|.:.:|.|:::|.||.|||..|.|||..||||.|:::|.|::||.||:.|..:.|:..
plant    40 REERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIVRAFGVLKKCAAKVNMEYGLDPM 104

  Fly    89 LCDAISKACDDVISGKLYDEEHFPLVIWQDGSGEHTNMNVNEVICNRAIEILGGQMGSKEPVDPN 153
            :.:||.:|..:|..|||.|  |||||:||.|||..:|||.||||.|||.||||.:.|.| .|.||
plant   105 IGEAIMEAAQEVAEGKLND--HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEK-IVHPN 166

  Fly   154 EHVNMAQSSHDTFSTAVRIAVAMQLQETLYPSLRTFIDLLGKKSNDWMDLIKIGRTHLMDAVPLS 218
            :|||.:|||:|||.|.:.||.|.::...|.|||:.....|..||.::.|::||||||..||.||:
plant   167 DHVNRSQSSNDTFPTVMHIAAATEITSRLIPSLKNLHSSLESKSFEFKDIVKIGRTHTQDATPLT 231

  Fly   219 LGQEFSGYQQQLVNGRTRLDCAMCRLYQLPMGGTSVGTKVDTKAEYSAQCIKRIAELTFLPFVES 283
            |||||.||..|:..|..|:.|.:.|:|||..|||:|||.::||..:..:....:||.|.||||.:
plant   232 LGQEFGGYATQVEYGLNRVACTLPRIYQLAQGGTAVGTGLNTKKGFDVKIAAAVAEETNLPFVTA 296

  Fly   284 PNFFESISACDCLVELHGELNTIAASVMKIANDIRFLGSGPRCGFGELHLPENEPGSSIMPGKVN 348
            .|.||:::|.|..||..|.|||||.|:|||||||||||||||||.|||.||||||||||||||||
plant   297 ENKFEALAAHDACVETSGSLNTIATSLMKIANDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVN 361

  Fly   349 PTQCEAMSMICAQVMGNHVAVSMGGSSGHFQLNTFMPMIASNVLRSITLLGDGMKSFCTNCLEGI 413
            ||||||::|:|||||||||||::|||:|||:||.|.|:|||.:|.||.|:.|...||..||:.||
plant   362 PTQCEALTMVCAQVMGNHVAVTIGGSNGHFELNVFKPVIASALLHSIRLIADASASFEKNCVRGI 426

  Fly   414 EPNRSKIGSIVKESLMLVTALSPHIGYERSAAIAKAAHHNGTTLE 458
            |.||.:|..::.|||||||:|:|.|||:.:||:||.||..|.||:
plant   427 EANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKRAHKEGCTLK 471

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fum4NP_723527.1 fumC 22..483 CDD:234779 244/436 (56%)
Fumarase_classII 24..480 CDD:176465 244/436 (56%)
FUM2NP_851166.1 Fumarase_classII 40..471 CDD:176465 244/434 (56%)
PLN00134 46..503 CDD:215069 241/430 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1022919at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11444
Phylome 1 0.910 0.794 Consistency score
33.020

Return to query results.
Submit another query.