DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fum4 and Fum2

Sequence 1:NP_723527.1 Gene:Fum4 FlyBaseID:FBgn0051874 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_727109.2 Gene:Fum2 FlyBaseID:FBgn0029890 Length:503 Species:Drosophila melanogaster

Alignment Length:461 Identity:283/462 (61%)
Similarity:366/462 (79%) Gaps:0/462 (0%)


  Fly    24 RVEYDSMGAVHIPLDRMFGPQTMRSLMKFPIGGVEERMPRPLIKALGIVKKSAAETNKIHCLEEH 88
            |.|.|:.|.:.:|.|:::|.|||||.:.||||.:.||||.|:|:|:||:||:.||.||.:.|:..
  Fly    43 RTEKDTFGELKVPADKLYGAQTMRSKLNFPIGDIGERMPMPVIQAMGILKKACAEVNKDYGLDGK 107

  Fly    89 LCDAISKACDDVISGKLYDEEHFPLVIWQDGSGEHTNMNVNEVICNRAIEILGGQMGSKEPVDPN 153
            :.||:|.|||||||||||.:.||||||||.|||..||||.||||.|.||:::||::|||:||.||
  Fly   108 VSDAVSCACDDVISGKLYKQGHFPLVIWQTGSGTQTNMNTNEVISNAAIKMMGGELGSKKPVHPN 172

  Fly   154 EHVNMAQSSHDTFSTAVRIAVAMQLQETLYPSLRTFIDLLGKKSNDWMDLIKIGRTHLMDAVPLS 218
            :|||.:|||:|||.||:.|:|.|:|.|.|.|::....|.|..||:::.|:||||||||||||||:
  Fly   173 DHVNKSQSSNDTFPTAIHISVGMELNERLVPAVTHLRDALKSKSDEFKDIIKIGRTHLMDAVPLT 237

  Fly   219 LGQEFSGYQQQLVNGRTRLDCAMCRLYQLPMGGTSVGTKVDTKAEYSAQCIKRIAELTFLPFVES 283
            ||||||||.|||.||..|:...:.|:|:|.:|||:|||.::|:..::.:..|||:|||.||||.:
  Fly   238 LGQEFSGYTQQLTNGLERIKGCLPRVYELALGGTAVGTGLNTRKGFAEKVAKRISELTCLPFVSA 302

  Fly   284 PNFFESISACDCLVELHGELNTIAASVMKIANDIRFLGSGPRCGFGELHLPENEPGSSIMPGKVN 348
            ||.||:::|.|.:||:||.|||||.|:||||||||.||||||||.|||.||||||||||||||||
  Fly   303 PNKFEALAARDAMVEVHGVLNTIAVSLMKIANDIRLLGSGPRCGLGELMLPENEPGSSIMPGKVN 367

  Fly   349 PTQCEAMSMICAQVMGNHVAVSMGGSSGHFQLNTFMPMIASNVLRSITLLGDGMKSFCTNCLEGI 413
            |||||:|:|:|||||||.|||::|||:|||:||.|.|::.|||||||.||.||..:|..||:||:
  Fly   368 PTQCESMTMLCAQVMGNQVAVTIGGSNGHFELNVFKPLVVSNVLRSIRLLADGSMTFSKNCVEGL 432

  Fly   414 EPNRSKIGSIVKESLMLVTALSPHIGYERSAAIAKAAHHNGTTLEQEAILDGIQREDFREWVQPS 478
            :.|:.:|..|:.|||||||||:|||||:::|.|||.||.|.|||::||:..||..|.|:|||.|.
  Fly   433 QANKERIDKIMNESLMLVTALNPHIGYDKAALIAKTAHKNKTTLKEEALKTGITEEQFKEWVNPK 497

  Fly   479 KMLGPE 484
            :||||:
  Fly   498 EMLGPK 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fum4NP_723527.1 fumC 22..483 CDD:234779 282/459 (61%)
Fumarase_classII 24..480 CDD:176465 279/456 (61%)
Fum2NP_727109.2 fumC 42..503 CDD:234779 283/460 (62%)
Fumarase_classII 43..499 CDD:176465 279/456 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C29634593
eggNOG 1 0.900 E1_COG0114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1022919at2759
OrthoFinder 1 1.000 FOG0001878
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11444
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.