DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fum4 and fum1

Sequence 1:NP_723527.1 Gene:Fum4 FlyBaseID:FBgn0051874 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_588397.3 Gene:fum1 PomBaseID:SPCC18.18c Length:520 Species:Schizosaccharomyces pombe

Alignment Length:459 Identity:241/460 (52%)
Similarity:328/460 (71%) Gaps:3/460 (1%)


  Fly    24 RVEYDSMGAVHIPLDRMFGPQTMRSLMKFPIGGVEERMPRPLIKALGIVKKSAAETNKIHCLEEH 88
            |.|.|:.|.:.:|.::.:|.||.|||..|.|||.:||:|.||::|.|::|::||..|:...|:..
pombe    59 RQESDTFGPIQVPAEKYWGAQTQRSLQNFRIGGEKERLPLPLVRAFGVLKRAAASVNREFGLDPK 123

  Fly    89 LCDAISKACDDVISGKLYDEEHFPLVIWQDGSGEHTNMNVNEVICNRAIEILGGQMGSKEPVDPN 153
            |.|||.:|..:||.|:|  :::||||::|.|||..:|||.||||.|||||||||.:|||:||.||
pombe   124 LADAIEQAAQEVIDGRL--DDNFPLVVFQTGSGTQSNMNSNEVIANRAIEILGGTLGSKKPVHPN 186

  Fly   154 EHVNMAQSSHDTFSTAVRIAVAMQLQETLYPSLRTFIDLLGKKSNDWMDLIKIGRTHLMDAVPLS 218
            :||||:|||:|||.|.:.||..:|:...|.|:::.....|..|..::.::|||||||:.||.|||
pombe   187 DHVNMSQSSNDTFPTVMHIASVLQIHTHLLPAMKHLHRALKGKEEEFKNIIKIGRTHMQDATPLS 251

  Fly   219 LGQEFSGYQQQLVNGRTRLDCAMCRLYQLPMGGTSVGTKVDTKAEYSAQCIKRIAELTFLPFVES 283
            ||||||||..|:..|..|::.|:.||..|..|||:|||.::|...:..:..:::::||.:.|..:
pombe   252 LGQEFSGYVTQVGYGIERINNALPRLCLLAQGGTAVGTGLNTFEGFDVKVAEKVSKLTNIEFKTA 316

  Fly   284 PNFFESISACDCLVELHGELNTIAASVMKIANDIRFLGSGPRCGFGELHLPENEPGSSIMPGKVN 348
            ||.||:::|.|.:||:.|.||.||.|:||||||||.||||||||.|||.||.|||||||||||||
pombe   317 PNKFEALAAHDAIVEMSGALNVIACSLMKIANDIRQLGSGPRCGLGELILPANEPGSSIMPGKVN 381

  Fly   349 PTQCEAMSMICAQVMGNHVAVSMGGSSGHFQLNTFMPMIASNVLRSITLLGDGMKSFCTNCLEGI 413
            ||||||::|:||||||||..:::.|:|||.:||.|.|::|.|:|.||.||||..:||..:|:.||
pombe   382 PTQCEALTMVCAQVMGNHATITVAGASGHCELNVFKPLLAKNILSSIRLLGDACESFTDHCVVGI 446

  Fly   414 EPNRSKIGSIVKESLMLVTALSPHIGYERSAAIAKAAHHNGTTLEQEAILDGI-QREDFREWVQP 477
            |||...|...:::||||||||:|||||:..|.|||.|..|.:||:.|.:..|. ..|.|.|||:|
pombe   447 EPNYEGIARHLRDSLMLVTALNPHIGYDNCAKIAKTALKNKSTLKHEFVTLGFGTPEQFDEWVRP 511

  Fly   478 SKML 481
            ..|:
pombe   512 ELMI 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fum4NP_723527.1 fumC 22..483 CDD:234779 241/460 (52%)
Fumarase_classII 24..480 CDD:176465 240/457 (53%)
fum1NP_588397.3 fumC 57..519 CDD:234779 241/460 (52%)
Fumarase_classII 59..514 CDD:176465 240/457 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001878
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11444
Phylome 1 0.910 0.788 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.970

Return to query results.
Submit another query.