DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fum4 and fum-1

Sequence 1:NP_723527.1 Gene:Fum4 FlyBaseID:FBgn0051874 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_498642.1 Gene:fum-1 WormBaseID:WBGene00001503 Length:501 Species:Caenorhabditis elegans

Alignment Length:472 Identity:276/473 (58%)
Similarity:349/473 (74%) Gaps:5/473 (1%)


  Fly    16 ARLIVPDTRV--EYDSMGAVHIPLDRMFGPQTMRSLMKFPIGGVEERMPRPLIKALGIVKKSAAE 78
            :|..||..::  |.|:.|.:.:|.|:.:|.||.||.|.|.|||.|||||.|:|.|.||:||:||.
 Worm    32 SRTTVPMAKIRKERDTFGELEVPADKYYGAQTARSQMNFKIGGPEERMPIPVIHAFGILKKAAAL 96

  Fly    79 TNKIHCLEEHLCDAISKACDDVISGKLYDEEHFPLVIWQDGSGEHTNMNVNEVICNRAIEILGGQ 143
            .|....|::.|.||||:|.|:|:.|||  :||||||.||.|||..:||||||||.|||||||||:
 Worm    97 VNTEFGLDKKLADAISQAADEVVDGKL--DEHFPLVTWQTGSGTQSNMNVNEVISNRAIEILGGE 159

  Fly   144 MGSKEPVDPNEHVNMAQSSHDTFSTAVRIAVAMQLQETLYPSLRTFIDLLGKKSNDWMDLIKIGR 208
            :|||:||.||:||||:|||:|||.||:.|||..::...|.|:|:.....|..|:.::.|:|||||
 Worm   160 LGSKKPVHPNDHVNMSQSSNDTFPTAMHIAVGREVNSRLLPALKKLRTALHNKAEEFKDIIKIGR 224

  Fly   209 THLMDAVPLSLGQEFSGYQQQLVNGRTRLDCAMCRLYQLPMGGTSVGTKVDTKAEYSAQCIKRIA 273
            ||..|||||:||||||.|..||.|...|::..:.|||||..|||:|||.::|:..::.:....::
 Worm   225 THTQDAVPLTLGQEFSAYVTQLDNSIARVESTLPRLYQLAAGGTAVGTGLNTRKGFAEKVAATVS 289

  Fly   274 ELTFLPFVESPNFFESISACDCLVELHGELNTIAASVMKIANDIRFLGSGPRCGFGELHLPENEP 338
            |||.||||.:||.||:::|.|.|||:||.|||:|.|.|||.|||||||||||||.|||.||||||
 Worm   290 ELTGLPFVTAPNKFEALAAHDALVEVHGALNTVAVSFMKIGNDIRFLGSGPRCGLGELSLPENEP 354

  Fly   339 GSSIMPGKVNPTQCEAMSMICAQVMGNHVAVSMGGSSGHFQLNTFMPMIASNVLRSITLLGDGMK 403
            ||||||||||||||||::|:.||||||.||||:|||:|||:||.|.|:|..|||:|..||.|...
 Worm   355 GSSIMPGKVNPTQCEAITMVAAQVMGNQVAVSVGGSNGHFELNVFKPLIVRNVLQSTRLLADSAV 419

  Fly   404 SFCTNCLEGIEPNRSKIGSIVKESLMLVTALSPHIGYERSAAIAKAAHHNGTTLEQEAILDGI-Q 467
            ||..:|::||..|:..|..|::|||||||||:|||||:.:|.|||.||.|||||.|||:..|| .
 Worm   420 SFTDHCVDGIVANKDNIAKIMRESLMLVTALNPHIGYDNAAKIAKTAHKNGTTLVQEAVKLGILT 484

  Fly   468 REDFREWVQPSKMLGPE 484
            .|.|.:||:|..||||:
 Worm   485 EEQFAQWVKPENMLGPK 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fum4NP_723527.1 fumC 22..483 CDD:234779 272/464 (59%)
Fumarase_classII 24..480 CDD:176465 269/459 (59%)
fum-1NP_498642.1 fumC 38..501 CDD:234779 273/465 (59%)
Fumarase_classII 42..497 CDD:176465 269/457 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C29634658
eggNOG 1 0.900 E1_COG0114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S145
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1022919at2759
OrthoFinder 1 1.000 FOG0001878
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11444
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.760

Return to query results.
Submit another query.