DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fum4 and LOC100535417

Sequence 1:NP_723527.1 Gene:Fum4 FlyBaseID:FBgn0051874 Length:484 Species:Drosophila melanogaster
Sequence 2:XP_003199715.2 Gene:LOC100535417 ID: Length:332 Species:Danio rerio

Alignment Length:326 Identity:189/327 (58%)
Similarity:242/327 (74%) Gaps:1/327 (0%)


  Fly   160 QSSHDTFSTAVRIAVAMQLQETLYPSLRTFIDLLGKKSNDWMDLIKIGRTHLMDAVPLSLGQEFS 224
            |||:|||.||:.||.|.::.|.|.|.|:|..|.|..|:..:.|:|||||||..|||||||||||.
Zfish     7 QSSNDTFPTAMHIAAAKEVHEVLLPGLQTLHDALAAKAEQFKDIIKIGRTHTQDAVPLSLGQEFG 71

  Fly   225 GYQQQLVNGRTRLDCAMCRLYQLPMGGTSVGTKVDTKAEYSAQCIKRIAELTFLPFVESPNFFES 289
            ||.||:.....|:..::.|:|:|..|||:|||.::|:..::.:...:::.||.||||.:.|.||:
Zfish    72 GYVQQVKYSIARVKASLPRVYELAAGGTAVGTGLNTRIGFAEKVADKVSALTGLPFVTAANKFEA 136

  Fly   290 ISACDCLVELHGELNTIAASVMKIANDIRFLGSGPRCGFGELHLPENEPGSSIMPGKVNPTQCEA 354
            ::|.|.||||.|.|||:|.|:|||||||||||||||.|.|||.||||||||||||||||||||||
Zfish   137 LAAHDALVELSGALNTVAVSMMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQCEA 201

  Fly   355 MSMICAQVMGNHVAVSMGGSSGHFQLNTFMPMIASNVLRSITLLGDGMKSFCTNCLEGIEPNRSK 419
            |:|:.||||||||.|::|||:|||:||.|.|||..|||.|..||||...||..||:.|||.|..:
Zfish   202 MTMVAAQVMGNHVGVTVGGSNGHFELNVFKPMIIKNVLNSARLLGDASVSFTNNCVVGIEANTER 266

  Fly   420 IGSIVKESLMLVTALSPHIGYERSAAIAKAAHHNGTTLEQEAI-LDGIQREDFREWVQPSKMLGP 483
            |..::.|||||||||:|||||:::|.|||.||.:|:||::.|: |..:..:.|.|||:|..||||
Zfish   267 INKLMSESLMLVTALNPHIGYDKAAKIAKTAHKDGSTLKEAALKLGFLNEQQFEEWVRPHDMLGP 331

  Fly   484 E 484
            :
Zfish   332 K 332

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fum4NP_723527.1 fumC 22..483 CDD:234779 188/324 (58%)
Fumarase_classII 24..480 CDD:176465 185/321 (58%)
LOC100535417XP_003199715.2 fumC <7..332 CDD:234779 189/325 (58%)
Lyase_I_like <7..328 CDD:294018 185/321 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1022919at2759
OrthoFinder 1 1.000 FOG0001878
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11444
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.